CAZyme Information: PV10_01840-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_01840-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	KN847520|CGC7	49387.89	9.6407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:5822582-5824032(+)

Full Sequence      

MIHARLQQKRPFVTLFLVFVLWKAILILITLGSPGVGYDTSTSLLPLQGHSWTLQTLPPA
FQSQWLRWVRWDAIYFTHIAEHGHVYEQEWAFGVGFSTATSWIANILSAWAVVDESASTI
IAAMLLSHTAHLLSVVQLFFLGHLLSDGASHTQSPIPFRAALLHILSPAGIFLSSPNAES
TFAFLSMSGCVAYVYAVHRFHRSQPLAGSLAMIAAGLALGAATIFRSNGLLAGLTFLVEA
FSVLFSIATQGLSALRLLRLVSTIVGGSLIAVGLAIPQVMAFQDYCAHRPNDLRREWCNR
TIPSIFTWVQDHYWNVGLFRYWTLSNLPLFLLAAPALFILSYSALDLMYAPRLLSTVKPR
SSEKVSLRDKTTVVALALPQLLIAILALTSYHVQIITRLSSGYPLWYIWLASQMESRAQM
TQITIRWMVVYALLQAGLYAGFLPPA

Enzyme Prediction     

No EC number prediction in PV10_01840-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	18	446	1.4e-102	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.12e-33	13	446	2	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	8.21e-08	61	446	67	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	3.94e-96	6	446	16	469
BCS12914.1|GT76	3.94e-96	6	446	16	469
QMW40534.1|GT76	1.34e-95	6	446	13	452
QRD82967.1|GT76	1.34e-95	6	446	13	452
QMW28463.1|GT76	1.34e-95	6	446	13	452

PDB Hits     

PV10_01840-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	3.43e-91	6	446	13	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.22e-88	8	446	7	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	4.10e-88	7	446	25	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	8.71e-82	3	446	11	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.20e-43	10	446	2	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

Start	End
12	34
90	112
119	141
180	197
206	225
229	248
260	282
318	340
374	396
423	445