CAZyme Information: PV10_01719-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_01719-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	KN847520|CGC3	61254.93	7.0353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:5397446-5399336(+)

Full Sequence      

MATTTQLSPTDVDSFDYVIVGGGTAGCVIASRLAEYLPNKKTLLIEAGPSDFMDDRVLDL
KQWLNLLGGELDYDYGTTEQPNGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKIWESL
GAEGWTFPTMMRVLNKLRNTVQPVHARHRNQLCKDWVESCSTAMDIPVIHDFNQEISTKG
ALRPGVGFFSVSYNPDDGRRSSASVAYIHPILRGDEKRPNLTILTNAWVSKINVKGGDTV
TGVTLKLQSGETRTLTAKTETILCAGAVDTPRLMLLSGLGPKQQLTSLSIPVVKDIPGVG
ENLLDHPETIIIFELNKPVPPNQTTMDSDAGIFLRRQPPNAAAKTPSPIFNPKALPDGDI
ADVMMHCYQIPFTLNTTRLGYDSPIDAFCMTPNIPRPRSRGRLYLTSADPSVKPALDFQY
FTDPEGYDAATFVFGLRAARKIAQQAPFKDWIKREVAPGPKVNTDEELSEYARRVAHTVY
HPAGTTKMGDVDSDKLAVVDAKLKVKGLKGVRIADAGVFPAMTTINPMLTVLAVGERAAE
LIAYDAGWQGPADEVRSRL

Enzyme Prediction     

No EC number prediction in PV10_01719-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	543	3.5e-138	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.58e-109	14	547	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.17e-102	14	542	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.04e-42	397	538	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.35e-28	14	535	55	569	Protein HOTHEAD
366272	GMC_oxred_N	8.66e-23	15	308	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7217204.1|AA3_2	0.0	1	550	1	537
EAA64559.1|AA3_2	0.0	1	549	1	536
QKX54836.1|AA3_2	0.0	1	549	1	536
QRC92500.1|AA3_2	0.0	2	550	3	537
ATQ35968.1|AA3_2	0.0	1	549	1	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	3.86e-119	15	542	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	5.44e-119	15	542	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.53e-118	15	542	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4UDP_A	1.49e-50	15	546	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6YS1_AAA	4.56e-50	8	542	1	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.98e-118	15	542	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	3.35e-68	13	543	5	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9X2M2|BETA_STAXY	7.23e-66	13	542	3	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus OX=1288 GN=betA PE=3 SV=1
sp|Q8NUM0|BETA_STAAW	3.31e-65	14	542	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=betA PE=3 SV=1
sp|Q6G664|BETA_STAAS	3.31e-65	14	542	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000009

TMHMM  Annotations     

There is no transmembrane helices in PV10_01719-t45_1-p1.