CAZyme Information: PV10_01716-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_01716-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931	KN847520|CGC15	102004.93	7.6793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:5388215-5391221(-)

Full Sequence      

MATNGDLGSRWDDTRQLGQLFMMGFDGASVTDQVKTLIEKYHVGSILLKAQNLKSAEQAT
KLILDLQTLARQAGHPVPLLIALDQENGGVNSLYDETHIRQFPSAMGVAATGNKRLAKEI
ARATAQELHACGINWILGPVLDVLTNARNQPLGVRSIGVDPQEVSAYGLECIKGYQEGGL
ATCGKHFPSYGNLEFFGVPDDVPTITDSLENLSQSALVPFQTAISHGLDAMMVGGVAMAS
TQLNVMHACLSEQIVRDLLRNEMHFDGVVVSECLEMEALSRNIGISNGTLMAFKAGCDLI
LTCRTLSVQEDAINGLKLAIENCTIDGLRIKESLQRVLKMKARYTSWEKAFSPPGIEKLN
RLRPIHTSLSTAAYGKSISVVRDDNQYLPLTRVINPEEELLLLTPLVKPLPASALFHHIQ
EEYSALSSFTARSPSVDTNTSVMSGEQVFRELGKNMAKYRRGKLSHTSYTANGVRPLHEN
LLSRAGAVVIVTADAGRNKYQNAFAKHISMLCKLAVGPNGAPKPKPCVVVAVSSPFDFAS
DSAIGTYVCTYDFTDTALLALVKVLYGELSSAGTLPGSLVQKPQTSHSRQHWLVEGFNED
RDRTALEFLLEQCRAEPSIHASLLRDTTTNTFLLRDPNVEEAHFVVRNSSTKELFGFCTT
YFNKNSGVGHLGAIIVDPARRRLSIGHSLHDRAVRALLQRKGILKFQLGVRYPSLYLGIP
RIDPVESRNLRQWFAKLGWNISLSTSVFTMTLQNLPSWSPPEGLAQSLAKTEVKYDLVYG
QEYADAILDHLTRSARLDVQGLYTAALAHKDHAGIIRAKLVSDQSILASILVLKPGFKGA
EHISSWTRGTGMCCISSPVISTKYGDRVSLFKGILLLALKHFRKQSAPAIILDYAREDVT
TEALTALGFNTEISFDEIISDPSHWTMMSQG

Enzyme Prediction     

No EC number prediction in PV10_01716-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	74	301	1e-55	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.58e-73	16	391	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.16e-66	17	338	6	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.43e-36	22	343	5	308	beta-hexosaminidase; Provisional
185053	PRK15098	4.79e-11	77	299	104	317	beta-glucosidase BglX.
178629	PLN03080	6.62e-11	102	448	114	482	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	13	929	5	922
BCS15461.1|GH3	0.0	11	929	12	929
QGA17051.1|GH3	0.0	4	928	5	949
BAE65506.1|GH3	0.0	11	929	41	959
QMW48185.1|GH3	0.0	11	929	12	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.28e-87	15	782	11	720	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.99e-61	15	579	15	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	6.40e-44	16	583	47	623	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.37e-44	16	583	21	597	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.24e-43	16	583	51	627	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.29e-43	16	583	47	623	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.51e-33	13	392	28	400	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	9.14e-30	33	390	54	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q6LJ30|NAGZ_PHOPR	1.44e-27	22	316	5	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
sp|Q3SKU2|NAGZ_THIDA	4.20e-27	17	313	3	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV10_01716-t45_1-p1.