CAZyme Information: PV10_01514-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_01514-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	KN847520|CGC4	73249.52	5.0563

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

Full Sequence      

MAARPLQLKAPGSLAGTLAEYEAPNQSSDTSNAPVDSEPTQPEIPERPGSKSLYEFTLPS
LHFLRWRPLYHVQAPTGWMNDPCGPGYDATTGLYHLFFQWNPRRNLHGSVAWGSIHWDHA
FSRDMINWTISGISALTPEAWYDKEGCFTGCLVPTSPDGQPGQLTILYTGVGRLPLHYTL
PYTRGTETLALAESSDGGLTWSKTKANPILPEPPVGIDVTGWRDPYVSRWPAMDRLLDID
PSEDIMYGMISGGVRHRTPTAFLYAVNPSNLTQWRYINAIVDVGLNHNISRWSGDMGINW
ECACFMTLSDHDNESSREFIVVGGEGTDTSHPESTFAAYPQESTKFPRTERSLQWMSGTL
TTNMNDQGQKVPKMEYTFGGKFDHGLLYAVNIFRDPATSKQIAWGWITEEDLPQKLVDRQ
NWSGLLSLPRELSLITLKGVTKALNSKLKEITSLEVTPESEDTFIIRTLGVAPASCLQAL
RRDTRQVAIEGSPTLTPVGDCFMGVQTCRFELSALLQVSDACTRIGLSIFHNEDHDITSS
TSIYLVPETETLQIERPDSTKIDPNILTFAESAPFTLFSFKRGGYQERELLELRVFFDES
VVEVFANSRCTFSTRVYPASKRCWGLKFWAEDESRQSTLVHAQAWDGLRADMKVA

Enzyme Prediction     

EC	3.2.1.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	71	434	2.2e-66	0.9590443686006825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350133	GH32_XdINV-like	7.89e-168	77	436	1	337	glycoside hydrolase family 32 protein such as Xanthophyllomyces dendrorhous beta-fructofuranosidase (Inv;Xd-INV;XdINV). This subfamily of glycosyl hydrolase family GH32 includes fructan:fructan 1-fructosyltransferase (FT, EC 2.4.1.100) and beta-fructofuranosidase (invertase or Inv, EC 3.2.1.26), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. Xanthophyllomyces dendrorhous beta-fructofuranosidase (XdINV) also catalyzes the synthesis of fructooligosaccharides (FOS, a beneficial prebiotic), producing neo-FOS, making it an interesting biotechnology target. Structural studies show plasticity of its active site, having a flexible loop that is essential in binding sucrose and beta(2-1)-linked oligosaccharide, making it a valuable biocatalyst to produce novel bioconjugates. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	1.43e-67	71	607	1	435	Glycosyl hydrolases family 32.
350110	GH32_FFase	7.65e-61	77	434	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
395193	Glyco_hydro_32N	1.51e-54	71	439	1	302	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
224536	SacC	3.42e-49	66	619	28	460	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89045.1|GH32	BCR89045.1|GH32	1.79e-168	66	648	44	594
BCS14065.1|GH32	BCS14065.1|GH32	1.53e-163	65	651	13	597
BCS02389.1|GH32	BCS02389.1|GH32	1.53e-163	65	651	13	597
CAP80067.1|GH32	CAP80067.1|GH32	2.43e-161	65	648	46	622
CAK42201.1|GH32|3.2.1.26	CAK42201.1|GH32|3.2.1.26	3.89e-161	57	651	5	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XH8_A	5XH8_A	5.59e-56	63	616	23	565	Aspergillus kawachii beta-fructofuranosidase complexed with glycerol [Aspergillus luchuensis IFO 4308],5XH9_A Aspergillus kawachii beta-fructofuranosidase [Aspergillus luchuensis IFO 4308],5XHA_A Aspergillus kawachii beta-fructofuranosidase complexed with fructose [Aspergillus luchuensis IFO 4308]
3LF7_A	3LF7_A	9.97e-53	63	614	23	594	Crystal structure of fructosyltransferase (wild-type) from A. japonicus [Aspergillus japonicus],3LFI_A Crystal structure of fructosyltransferase (wild-type) from A. japonicus in complex with glucose [Aspergillus japonicus],3LFI_B Crystal structure of fructosyltransferase (wild-type) from A. japonicus in complex with glucose [Aspergillus japonicus]
3LDK_A	3LDK_A	1.26e-51	63	614	23	594	Crystal Structure of A. japonicus CB05 [Aspergillus japonicus],3LDR_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with 1-Kestose [Aspergillus japonicus],3LEM_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with Nystose [Aspergillus japonicus],3LIG_A Crystal structure of fructosyltransferase (D191A) from A. japonicus [Aspergillus japonicus],3LIH_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with raffinose [Aspergillus japonicus]
5ANN_A	5ANN_A	4.32e-45	63	648	62	634	Chain A, Beta-fructofuranosidase [Phaffia rhodozyma],5ANN_B Chain B, Beta-fructofuranosidase [Phaffia rhodozyma]
6S82_A	6S82_A	4.32e-45	63	648	62	634	Chain A, Beta-fructofuranosidase [Phaffia rhodozyma],6S82_B Chain B, Beta-fructofuranosidase [Phaffia rhodozyma]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49175|INV1_MAIZE	sp|P49175|INV1_MAIZE	1.54e-33	49	618	107	624	Beta-fructofuranosidase 1 OS=Zea mays OX=4577 GN=IVR1 PE=3 SV=1
sp|P29000|INVA_SOLLC	sp|P29000|INVA_SOLLC	2.24e-33	64	492	100	467	Acid beta-fructofuranosidase OS=Solanum lycopersicum OX=4081 GN=TIV1 PE=2 SV=1
sp|P93761|INV1_CAPAN	sp|P93761|INV1_CAPAN	1.07e-30	25	454	56	439	Acid beta-fructofuranosidase AIV-18 OS=Capsicum annuum OX=4072 PE=2 SV=1
sp|P80065|INVB_DAUCA	sp|P80065|INVB_DAUCA	2.84e-30	64	653	127	654	Beta-fructofuranosidase, soluble isoenzyme I OS=Daucus carota OX=4039 GN=INV*DC4 PE=1 SV=2
sp|H2DF88|RHVI2_ROSHC	sp|H2DF88|RHVI2_ROSHC	1.09e-29	64	618	78	569	Acid beta-fructofuranosidase 2, vacuolar OS=Rosa hybrid cultivar OX=128735 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999848	0.000176

TMHMM  Annotations     

There is no transmembrane helices in PV10_01514-t45_1-p1.