CAZyme Information: PV10_01455-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_01455-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	KN847520|CGC13	43791.64	5.0071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:4564023-4565375(+)

Full Sequence      

MPVKDRIKEVWGDKVIGCFGTPEQDENPDAPSSAMYPGRCTHVLESRMWYLIIIMALVFN
PVAAETPFRKPMGRDWRLTRFLAPQAPPATAAAPTGTYQRSQGSQIPNPEVGVKNDVNAE
YRPNRDPGDVQDANGTWIVRNVGTFSNKAVYTFSGDTLPDGLYASDYTVQNRLGDDGPRT
GTLYNHRFDPANVQLSNGFVRLIVPSGQRPNRRPDKAISCAEIATTESNIISASVRTRAV
FSKVPGTCHGMFFYKNDTQEIDIEYLTDPTSLSNNGPREPIPIWYTNQPIDPENPEDHDS
TSETGPAPFDCTSRVHEYRIDWTPEYTAFYLDGIEQKRFTDNVPTTPGSWVWNNWANGDK
GWSKGPPKGTADNVFKIQSIWMYYNTSTETT

Enzyme Prediction     

No EC number prediction in PV10_01455-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	213	379	5.1e-42	0.8541666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	5.17e-34	162	383	8	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	3.17e-06	176	369	17	197	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.29e-05	260	364	64	168	Glycosyl hydrolases family 16.
185693	GH16_laminarinase_like	3.66e-05	260	353	115	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185692	GH16_fungal_CRH1_transglycosylase	6.59e-04	260	366	75	189	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI62369.1|GH16	3.24e-70	135	387	37	263
QPC71194.1|GH16	2.65e-69	135	387	38	264
QPC59862.1|GH16	2.65e-69	135	387	38	264
CZS81947.1|GH16	3.75e-69	135	387	38	264
CEF78656.1|GH16	3.75e-69	135	387	38	264

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	9.75e-09	181	355	28	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1MAC_A	1.19e-08	176	355	20	182	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	1.22e-08	176	355	22	184	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1CPN_A	5.08e-08	241	355	33	126	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]
1AJK_A	5.48e-08	241	355	8	101	Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-84 [Paenibacillus macerans],1AJK_B Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-84 [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45797|GUB_PAEPO	4.20e-09	149	355	21	208	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
sp|P23904|GUB_PAEMA	8.21e-08	176	355	45	207	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
sp|A3DBX3|GUB_ACET2	1.21e-07	181	355	57	215	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
sp|P04957|GUB_BACSU	3.81e-07	176	355	50	212	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
sp|Q84C00|GUB_ACETH	3.85e-07	181	355	57	215	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996300	0.003697

TMHMM  Annotations     

Start	End
49	68