CAZyme Information: PV10_00632-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_00632-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		40224.84	4.1391

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:1987636-1988721(+)

Full Sequence      

MLGLTIVALAFVDLRTEASFAPELPAPLASRSDSNCDLYIVSGHDADPFENHRFWDFRDL
GDYVTSEPPSITPDQDEGMENVTSHYFSQAAFSDAWKIRNGIRNPESEVPMIYSAQNAYL
STDPDSGGTQTYLTLRTTRLQDFQSVVQLASRDENILYASMRARMKIIPDDMDNGNVATG
AVLGFFTYASDTQESDIEILTRDPMDTVSFANQPASPTTPGVSRKFQIPGGKNWTEWVDY
RLDWLEGRSFWYMDDELLFQTTNSTPTEPSQLMLNLWSNGQSFSGRMRLNREVYVGVQWI
ETVFNLGNVPDETNGQTRCLVDSVATKGVPELIQSSEVSPLAVSTAVRALGIAVLSFIIL
T

Enzyme Prediction     

No EC number prediction in PV10_00632-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	301	8.9e-62	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.60e-39	87	301	3	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.83e-08	158	287	68	192	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX92358.1|GH16_22	1.48e-52	32	337	38	348
EAA63092.1|GH16_22	4.60e-52	14	327	31	358
AEO63760.1|CBM1|GH16_22	5.35e-52	32	333	31	342
AEO57601.1|GH16_22	9.80e-52	29	333	37	357
QKX57994.1|GH16_22	2.19e-51	33	333	40	386

PDB Hits     

PV10_00632-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV10_00632-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999707	CS pos: 18-19. Pr: 0.9857

TMHMM  Annotations     

There is no transmembrane helices in PV10_00632-t45_1-p1.