CAZyme Information: PV10_00387-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_00387-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	KN847520|CGC9	51287.15	6.4930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:1198896-1200332(+)

Full Sequence      

MVRPRMHQPCLVILPFLLLLASIAKAINLDLNSRESILHAASLTALDVRQLYKPTDPGGK
IGKFPFPPYYWWESGAAWGAMIEYYHYTGDKTHLNTTLEAILSQLGPRYDFELESERFDE
GNDDQAFWVFAAMSAAEYSLPQPRAPIPPWIRIAQNAWESFASRWMLSTGCNGGLKWQFH
AENAGWYYKSTISNGCFFQLSARLARFTGNDTYLHWANRIWDWSEGVGLIDDAYNVYDGT
DELINCSAIDHHQWSYNVGVYLYGAASLQNYTRSRLWLNRTLGLLDSVNTFVTPFPNSTN
IIFEAACELNNKCNTDQLSMKAYLARWLAATCLVAPFTAPRIGEIIRTSAQGAAASCTGG
PYSKTCGSKWFTHKWDGTSGLGQQLAAMEVIYALLVNETDPPANDLTVKIEPAPSVSLTP
TASATPHGTARPLHDAVEPPAKYKNKIHSFIAAVVTALALF

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	35	399	1.6e-88	0.9357541899441341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.11e-147	36	388	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.59e-06	154	272	116	225	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76159.1|GH76	1.58e-165	29	435	19	429
QSZ36627.1|GH76	6.38e-129	23	407	21	399
CCD44408.1|GH76	9.04e-129	23	407	20	398
ATZ53339.1|GH76	1.81e-128	23	407	20	398
QDS74953.1|GH76	3.01e-128	17	400	10	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	9.80e-92	31	407	30	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	2.38e-106	19	402	14	394	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	2.46e-103	19	402	11	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.23e-101	19	396	12	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	1.82e-98	27	404	19	391	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	3.14e-97	26	391	21	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999726	CS pos: 26-27. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in PV10_00387-t45_1-p1.