CAZyme Information: PV10_00153-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_00153-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	KN847520|CGC7	102691.50	4.8007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:466404-469205(-)

Full Sequence      

MTRLRRYRVFLIVAVISTFTLWHLSRLSDWTVSTLGGAVGFRPKPEDLPPPIDYTEPIPL
PIPEPQEPPVNAPTPVIHPVTPTPSPKTPAESPSTSTSTSPSPSPSPSPDLRPTVTGEEL
LAKPDSALDDFGERGQGRLEVQPRPHEQPKAYWKQQEEHFPVPPRSLKTLPTAKAKTLPK
IQYPFGKESAAKKNERQRRQTTIRESFKHAWYGYTNFSLGHDELKPLSGGSGNPFNGWGA
TLVDSLDTLWIMGLYDEFDRAVSLVKDIDFKTSTRKDIPLFETTIRYLGGLLGAYDISNG
KYQILLTKAVELAEVLMGAFDTPNRMPIGYYNWAPSYASQPHRASTHMVLAELGSLSVEF
TRLAQITKEDKYYDAIARITDALEKWQMKTTLPGLWPLKLDASGCKKPEIVRDSSITQTS
LPVFTDDDSVGKQPPKGEVPPSPPSHIDDDSPHHKREVSDEAPPLPKEEKKDDEPKEARV
ANPLSTPDFDEIDCEPQGLSTEPHSDAHRYGIGALADSTYEYLPKEYALLGGVNDQYKTM
YEHAMKVVREELLFRPMIKEDRDILFVSKQSISPREEIESKRKVTKYEGSHLGCFAGGMF
ALGSKMFDIPEDMTLARKLTEGCVWAYESMPVGIMAESFELVPCESMTACPWDEKKWHKA
LDPYLNERFKAVDNLNREQERLHEEALANAAKKAELSEAELSEAELSEAELSEAELSGAE
LSEADDDATPFSDSGTKRKRNAEGHAETEQNSEAELPSRTVDVKDGDTAEDTDHEVVPSF
VPRVALSHDKYVAARISEERLRPGYTNIGERDYRLRPEAIESIFIMYRITGDESWMEKGW
KMFLAVDQATKSEVAHAVVRDVTSLLNYQDDTMESFWLAETLKYYYLLFSEPSLVSLDDY
VLNTEAHPFKRPVS

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	207	911	5.5e-172	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	207	911	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.47e-95	156	912	26	519	glycoside hydrolase family 47 protein; Provisional
395648	Pentapeptide	0.003	699	725	1	27	Pentapeptide repeats (8 copies). These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid.
224276	YjbI	0.008	692	725	146	179	Uncharacterized protein YjbI, contains pentapeptide repeats [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63570.1|GH47	1.69e-239	131	914	147	899
BCS01562.1|GH47	4.76e-237	114	912	116	869
BCS13278.1|GH47	4.76e-237	114	912	116	869
QSS63392.1|GH47	6.16e-233	121	913	129	862
QSS69163.1|GH47	1.58e-232	129	913	133	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	2.62e-38	199	908	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.91e-38	199	908	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	3.02e-38	199	908	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.00e-37	199	908	88	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	1.24e-37	199	908	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	2.66e-40	202	909	200	642	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.62e-37	195	908	176	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	2.63e-36	199	908	249	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|O60476|MA1A2_HUMAN	5.26e-36	194	908	175	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|A2AJ15|MA1B1_MOUSE	1.44e-35	199	908	208	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999866	0.000155

TMHMM  Annotations     

Start	End
7	24