CAZyme Information: PV10_00052-t45_1-p1

Basic Information

• Species: Exophiala mesophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala mesophila
• CAZyme ID: PV10_00052-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		48496.13	6.4993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EmesophilaCBS40295	9237	N/A	56	9181

• Gene Location: location=KN847520:163375-164824(+)

Full Sequence      

MEPGRLPEWLNSPSSSPSPFSCYKTVPLVLKKRALISIFICLLLVALLSTQHREIVDHVQ
SLPNKLLRNSHEDVYNSTLGFEKIIAIGFPSRTDRRDAVILGASFTKMEVEWEAGVSFEE
VPVNAAPFTWDFEAQTTGALGSWRAHMNVLQRIVRENIQTTLIIEDDADWDVHLKSQMSE
MAYGLRALQQAPRSTRSPYGPAWDMLWLGHCRVGSTDDEQEFWVVDDDVTVAPTVNRTSF
FRNRHSPEITRRNNTRIFFHANAGMCVQAYAVTYDGARKMLAAISLQPRNQPFDVSVSAI
CRHKFLDPFVCYGAFPPLFSTHRFAGPTSRDSDISIAEEPDLIHEEYTKDLVYSTIMNIP
RLVQGLNSVQPQFKGQNIPDQLFLPDARPPPKGYLQTVVMYNETILPASTQASTQAPTQI
VSSVSHSPSKL

Enzyme Prediction     

No EC number prediction in PV10_00052-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	82	295	1.2e-26	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.79e-14	83	173	1	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	0.002	136	284	64	189	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65939.1|GT25	5.96e-72	73	379	128	432
QMW48687.1|GT25	4.15e-71	74	397	50	369
QRD92316.1|GT25	4.15e-71	74	397	50	369
QMW36631.1|GT25	4.15e-71	74	397	50	369
CAP93867.1|GT25	3.01e-67	63	373	41	360

PDB Hits     

PV10_00052-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV10_00052-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000014

TMHMM  Annotations     

There is no transmembrane helices in PV10_00052-t45_1-p1.