CAZyme Information: PV07_12442-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_12442-t44_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	KN847048.1|CGC1	37174.50	5.6931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847048.1:48772-49830(-)

Full Sequence      

MRSSYQTITIPTLLLSLIPLSHGSAANSTFPKRGLCYIATDHSESDSHIFTTSNSPLTWY
YNYSPWPGPSSSLAQWSTEFVPMVHSASDAAASVDTIKAILNGSAGIPLAASSGGGGRGN
RVTHVLTFNEPDGDTSTGGTDSAPDHAAQVYIDTILPLRAAPYHLQVSLPATTGSARGLE
WLRAFNVSCFRRRPAGGCAFDFVAAHWYGDLAGMASWLGTLHALYPAKPLWVTEFALPAA
PAAATQAFFNDSLPYLDALAYVPRYAWFGAFRSSGGDGNEWTGDQVSLFDGHGRLTDLGA
GYLGGDKDGFHEGESASNSAAAATAGFATTTMSWTMCLLLACSVVANLGWLL

Enzyme Prediction     

No EC number prediction in PV07_12442-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	51	302	1.6e-50	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.83e-49	45	302	6	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT61160.1|GH128	6.35e-81	32	348	34	332
CCT72013.1|GH128	5.94e-77	32	315	24	288
CAE7030955.1|GH128	1.13e-76	14	314	23	304
QGI84896.1|GH128	2.37e-76	32	315	24	288
QGI67667.1|GH128	2.37e-76	32	315	24	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	8.68e-10	59	274	47	241	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	2.12e-09	59	274	47	241	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	5.17e-09	59	274	47	241	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	5.17e-09	59	274	47	241	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

PV07_12442-t44_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999776	CS pos: 23-24. Pr: 0.9858

TMHMM  Annotations     

There is no transmembrane helices in PV07_12442-t44_1-p1.