CAZyme Information: PV07_12123-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_12123-t44_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	KN847047.1|CGC3	47263.19	8.8490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847047.1:132708-134174(+)

Full Sequence      

MRVAWLFSRQFQRRLLISLILSVLAIWCLLPPSPKHGVQPAELERQYPLLWRHVHTFNGT
GGAWYIPPSWLSSADFQPETIVDAALLASQAANSNKRRFIDRSSIPLVLHQTWKNRCVDT
WSDLLRASVEKWLNYVVSDDMAYFFWEDDGIVRMLAEFEPDFVHRFVALPSNVERADVFR
ILVLKWFGGIYADVDTRPLRRPASWVAASDLAPWTDSVTEMNFSFDNPVSSILGIEADCV
PHKNDYWRMGYSYPVQLTQWALASSSGHAILLRFMDTLQRRLEDIARRNRGDISVPEAVR
ELRQIGPVSLTGPVAVTVAAKTWLEERTGLRWNALTGLLDGGQSKLVEDVLILPITGFSP
GRGRYGNMGSKPVTDPSARVWHRAQGSWHTFNAKVEFGKVCRTLFGLCKDWPKQPG

Enzyme Prediction     

No EC number prediction in PV07_12123-t44_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.02e-15	97	271	71	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.37e-10	122	207	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57092.1|GT32	3.11e-169	7	413	7	414
QGA12609.1|GT32	3.44e-160	1	413	1	420
BCR93027.1|GT32	1.62e-156	13	415	7	408
BCS05686.1|GT32	1.62e-156	13	415	7	408
QMW48355.1|GT32	4.01e-155	10	413	7	409

PDB Hits     

PV07_12123-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.42e-21	100	388	111	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	3.98e-21	166	388	202	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	3.10e-13	102	388	93	469	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	7.34e-13	160	359	183	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	6.22e-11	103	228	55	179	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PV07_12123-t44_1-p1.