CAZyme Information: PV07_12073-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_12073-t44_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	KN847046.1|CGC2	60600.88	5.3388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847046.1:4017723-4019399(-)

Full Sequence      

MASSSYDYIIVGGGVAGLVLASRLSKLLPPSDMKQILVLEAGTDPSATDSILTSQAAHLA
RESVHSYQLSISPNRHLNGRGATVPVGKALGGSAAINGGAWTRGPKSDYDLWAKMVGDGS
WGYDALLPYMRRVESMVLPENIEKDEIQHGYDGPLKLTPIRSLWPARKYPLRESVQKMWE
EAGVKYIPDGNSGHQNGLVEFVEVWVNSARQLPSKIFDLTKVDVRTMSTVQRVTFGTIEG
QDQPVANGVDLVGGQHFVANKEVIVCAGAYHTPQVLMLSGIGDPAELAKHGIETITSNLE
VGRNLTDHLAVGITWKLKHPEKGLSIGSPLFIDPSYFSGWPMDFIEFGPLDEPAKLEPWI
NTPEERALVLRPDASHMEIVTLYVALGKRLTGIDAPLDGNYISTIAGYLTPTSRGSVTLR
SASIEDAPAIDMNFFDTDADKVGLREALRKAASVHLDTEAGKSFVSHEVTPEGYACITKD
TMDEEIDKRIADFGYSFDHPMGSCAMGKAVDSHCRVMGVKSLRVVDASVFPIPMACHPQS
VVYVTAERVADWISQGDQ

Enzyme Prediction     

No EC number prediction in PV07_12073-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	554	1.4e-129	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.56e-84	1	553	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.07e-80	1	553	1	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.31e-35	411	548	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.83e-34	4	542	54	565	Protein HOTHEAD
366272	GMC_oxred_N	5.40e-32	78	310	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16263.1|AA3_2	2.58e-144	3	551	2	549
BCS04695.1|AA3_2	2.58e-144	3	551	2	549
BCS24407.1|AA3_2	2.19e-142	6	554	4	560
UKZ69664.1|AA3_2	5.12e-142	7	553	10	551
CAK40717.1|AA3_2	7.45e-141	5	551	4	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	8.92e-50	6	555	41	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	5.76e-49	4	553	5	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	7.94e-49	4	553	5	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.09e-48	4	553	5	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4YNT_A	2.29e-46	1	555	1	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	3.24e-99	3	553	2	518	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.77e-53	3	557	38	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q4A0Q1|BETA_STAS1	9.71e-52	5	553	4	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.31e-51	5	553	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.31e-51	5	553	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000007

TMHMM  Annotations     

There is no transmembrane helices in PV07_12073-t44_1-p1.