CAZyme Information: PV07_11878-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_11878-t44_1-p1
• CAZy Family: GT41|GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	KN847046.1|CGC14	74105.16	5.1138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847046.1:3406094-3408195(-)

Full Sequence      

MRTILAFITVLGTTVSALTAAHRHSHNRFFRRDNTTQSIQGGNTTDPTAYDYVVVGSGPG
GGPLASRLAIAGYKVLLIEAGDDQGDAIWQQVPALQLQATEYTPMRWDYFVNHYQDLARQ
EEDSKMVWKTPSGDEYVGNSPPAGSTPLGIWYPRTGTLGGCSAHNAMITIYPHESDWNNI
ASITGDSSWSAGNMRKYFERMERCRYLPNSVVGHGFDGWYETSLTELSLAVEDQKLLSLI
IAAGTAMGKGLLGMVLSTVAGLGEVLLRDINADVPNRDSQEGLYQVPIAVTEVDKKRNGA
RDFILDTANAVNADGSRKYHLDVKLNTLVSKVRFDTSGPKPKAIGVDYLEGQSLYRADPR
AGTAAGGTPGSVNANREVIISGGAFNSPQLLKLSGIGPASELSKFGIPVIVDLPGVGTNL
QDRYEATIVGNSNTDFAITKDCTFLRTEPDPCLEQWQNLPGPSLKGTYATNGIAIAVVKK
SSVADGDPDLLISGAPAYFTGYHPGYANESLKDAHHWAWIVLKAHSRNNAGTIGLRSTDP
RDTPVINFNYFDTGNTANDADEKDLQATYEGMELSRKMFKDYIPLQGTFQEVWPGNQVTT
EAQMKDWIKKEAWGHHASCTCPIGGDDDEMAVLDSKFRVRGVDGLRVVDASVFPKIPGFY
IVLPTYMISEKAADAVLEDAANA

Enzyme Prediction     

No EC number prediction in PV07_11878-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	679	1.3e-99	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.50e-65	64	677	20	532	choline dehydrogenase; Validated
225186	BetA	8.31e-64	50	683	8	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.97e-31	531	672	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.24e-21	321	658	235	558	Protein HOTHEAD
366272	GMC_oxred_N	1.47e-13	153	425	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39616.1|AA3	0.0	10	681	8	678
QMW27545.1|AA3	0.0	10	681	8	678
UDD55433.1|AA3	0.0	10	681	8	678
QRD81945.1|AA3	0.0	46	681	26	659
BCS05589.1|AA3	0.0	61	681	49	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	7.35e-38	50	673	41	594	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	2.20e-35	50	676	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	2.20e-35	50	676	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	5.41e-35	50	676	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	1.01e-34	50	673	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6LGH5|BETA_PHOPR	3.13e-50	48	677	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.48e-47	50	676	46	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|C3K3D3|BETA_PSEFS	4.37e-47	50	676	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	4.96e-47	50	676	43	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	1.88e-46	50	677	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.016569	0.983407	CS pos: 17-18. Pr: 0.9583

TMHMM  Annotations     

There is no transmembrane helices in PV07_11878-t44_1-p1.