CAZyme Information: PV07_11397-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_11397-t44_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	KN847046.1|CGC12	76593.54	5.9026

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847046.1:1882589-1884709(+)

Full Sequence      

MREFWSYDVARIYLFSRTNCSMLFTLFVLILCYLSSMTSAVRYTEYILTPSSRTLYPVSV
YNINGTVKNAAGLVNSTAAATFTGQCAATYDFGKNIAGIVSFDFNTSGDAGETHIGISFT
ESSLWISSEGCDATADAGIDQALWFEISGAGHRQASKEHQRGGFRYLSVYHNSTDDVRLS
NLSVHFTAVPQKRESDLQAYTGFFHTNDEQLNRVWYAGAYTNELCTIDPTAGDALNYLGT
INSSSTINSPLPWYLNYTIATGASVLVDGAKRDRLVWPGDMSIAVPSIFVSTNDLSTVRN
SLDSLLRLQNSSTGALPYAGVPFGQAMPVFSFTYHLYSLIGIYDYYLYSGDEAYLARNWE
RFKFGLNYSISFIDPSGMANVTTSADWLRFGMGAHNIEANAILYHTLNLGATLANVMNDT
TVSAWSRYAAGIKNATNAQLWDPDANLYRDNDTTPFTELHPQDGNAWAVISNLTTSSAQN
INISNALAARWGPYGAPAPEAAATVSPFISGFELQAHYLAGQASNAVRLMKLMWGDFMLD
DPRMTNSTFIEGYSTNGDLHYAPYSNDPRISHAHGWATGPTNALTFYAAGLQVTGAAGRT
WKISPMLGGLAFAEAGFQSPLGLFEINATSVENGGLNVTFNTPAQTTGSVIFAHQTGVRG
HVIVSKVQGGTRLTKRVTISLGGAGTTEIHGLRGGSYEASLIVHQV

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	87	651	4.2e-85	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	7.44e-06	201	482	3	260	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
273702	oligosac_amyl	0.003	339	444	359	461	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09184.1|GH78	2.55e-286	37	650	17	634
CCD42947.2|GH78	3.51e-284	24	701	6	686
ATZ51240.1|GH78	7.06e-284	38	701	18	686
QSZ29924.1|GH78	9.67e-266	39	650	21	638
SMR48306.1|GH78	9.82e-243	34	692	10	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.41e-17	90	622	196	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	3.74e-06	265	580	234	534	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

PV07_11397-t44_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.561806	0.438195

TMHMM  Annotations     

Start	End
21	43