CAZyme Information: PV07_10834-t44_2-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_10834-t44_2-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		96322.39	7.4144

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847045.1:4096697-4099657(+)

Full Sequence      

MGKKQDISRQLAVLPPLQLPNTTVHTDNAIILDEPDSPLPDALLDDTTSVLDDGRVSLNF
DSKLAQVFAKLIEASEDEEDTVEPPPAYSTISQLDSWKLPLNIVIQIVGSRGDVQPFVAL
GQELLRHGHRVRLATHSVFREFVENAGLEFYSVGGDPAELMAYMVKNPGLLPRMKALREG
DVSKNRQMIREILEGCWASCISPSDNGDPFVANAIIANPPSFAHIHCAQALGIPLHIMFT
MPWSPTRAFPHPLANIRNGNTDPKLANYISYGMVQLLTWNGIGDIVQNWRKSIDLEAIPM
SEAPFLMETLQVPHTYCWSPALAPKPKDWGMHIDVCGFLLRDPTPYTVPVDLEEFLRSGP
TPIYIGFGSIVVENPEKILQILLAAVKECCVRAIISKGWSNLESEAVDENVFFLGECPHE
WLFQQVSVVVHHGGAGTTASGLMHGRPTVIVPFFGDQPFWGNVVATSRAGPPPISYKKLN
SKNLSNSIRYCLREETQSAAKDVAVKMAAEMGVKTAVHSFHRHLPVDDMGCDLINGLPAT
WVYRKSKTHLKISGAAAEILIQAKRIKADDLRLYKSKPFTIENRRWDFLTSSLAVSMEMS
YDILAAVSGFWRNPRAVRKQKDKERALGRASSHQSEPGLDIDSGEGSSKQIAKMVGASAM
SLSQITGIVIKGSLVDIPVAVAEGLRNTPKLYGQEVPDHAAVTDWKSGLKVAGTTFVHQM
GQGLTDLMVQPAKGLAKEGIIGFGKGIGKGALQTATKPTSACMGLIGYTGQGIYKSIYAA
VHSKTKKSVASAQRVQDKYFIRANGMDISTGQVVDEFDRLCRRWLKSESGGPNGGLTPTV
VSRTASFVSTQTQSMSSATPIPTDNQATAYRYITPPGDPPASSP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	113	523	1.4e-47	0.9712041884816754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.97e-77	101	523	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.04e-47	103	523	4	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.43e-24	103	250	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	7.01e-07	112	465	7	331	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	4.70e-291	6	822	16	858
UQC79556.1|GT1	7.14e-280	36	835	16	850
CEI68149.1|GT1	2.19e-279	52	822	74	853
CEF86870.1|GT1	2.15e-277	52	823	74	862
QKD61343.1|GT1	4.46e-276	50	796	21	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.05e-80	82	524	4	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.24e-80	82	524	24	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	3.86e-27	101	473	1	337	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	4.53e-27	101	504	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	3.31e-22	101	504	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.86e-123	83	525	132	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	9.07e-121	100	525	192	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A7A179|ATG26_YEAS7	5.67e-76	54	524	695	1159	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1
sp|Q06321|ATG26_YEAST	1.93e-75	54	524	695	1159	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1
sp|A1CFB3|ATG26_ASPCL	2.30e-73	101	524	908	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PV07_10834-t44_2-p1.