CAZyme Information: PV07_10834-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_10834-t44_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		67402.40	9.3143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847045.1:4097586-4099657(+)

Full Sequence      

MGRAGPPFRRCPADFSPRIGDIVQNWRKSIDLEAIPMSEAPFLMETLQVPHTYCWSPALA
PKPKDWGMHIDVCGFLLRDPTPYTVPVDLEEFLRSGPTPIYIGFGSIVVENPEKILQILL
AAVKECCVRAIISKGWSNLESEAVDENVFFLGECPHEWLFQQVSVVVHHGGAGTTASGLM
HGRPTVIVPFFGDQPFWGNVVATSRAGPPPISYKKLNSKNLSNSIRYCLREETQSAAKDV
AVKMAAEMGVKTAVHSFHRHLPVDDMGCDLINGLPATWVYRKSKTHLKISGAAAEILIQA
KRIKADDLRLYKSKPFTIENRRWDFLTSSLAVSMEMSYDILAAVSGFWRNPRAVRKQKDK
ERALGRASSHQSEPGLDIDSGEGSSKQIAKMVGASAMSLSQITGIVIKGSLVDIPVAVAE
GLRNTPKLYGQEVPDHAAVTDWKSGLKVAGTTFVHQMGQGLTDLMVQPAKGLAKEGIIGF
GKGIGKGALQTATKPTSACMGLIGYTGQGIYKSIYAAVHSKTKKSVASAQRVQDKYFIRA
NGMDISTGQVVDEFDRLCRRWLKSESGGPNGGLTPTVVSRTASFVSTQTQSMSSATPIPT
DNQATAYRYITPPGDPPASSP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	35	260	4.6e-44	0.5157068062827225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.55e-44	1	260	141	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.28e-29	80	260	220	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	0.003	100	202	228	331	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	1.69e-171	19	559	303	858
UQC79556.1|GT1	2.22e-168	19	572	276	850
CEI68149.1|GT1	1.40e-167	19	559	307	853
CEF86870.1|GT1	3.29e-166	19	560	307	862
QKD61343.1|GT1	1.72e-165	19	533	256	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	5.47e-38	23	261	193	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	7.38e-38	23	261	213	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.17e-22	20	210	150	337	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	7.68e-22	57	241	200	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	4.78e-19	57	241	200	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	4.29e-58	49	262	396	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.07e-57	49	262	359	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	5.64e-40	23	262	1339	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A1CFB3|ATG26_ASPCL	1.30e-37	15	261	1071	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	3.98e-37	5	329	883	1191	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000010

TMHMM  Annotations     

There is no transmembrane helices in PV07_10834-t44_1-p1.