CAZyme Information: PV07_10231-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_10231-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	KN847045.1|CGC3	59947.50	5.7451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847045.1:1950689-1952977(+)

Full Sequence      

MSNQFDFIVVGAGAAGCLLASRLSRTSTAPSVLLIEAGNVLDNPDLRDAGRKFVNLADPS
LGWADYSHTQKNVNGRSIIYPRGKGLGGSTMTNAMVYYVGSSEEYDYWAEVTGCPKWRWP
ETKERFRRIERFHDDTPTEFRKYAHASPENHGSTGPIDVSLPSVWEPGVSKVFEIAQAHG
YPINLDQNSGNPIGIGLSPTTVSHGLRTTAASAFLDNRPPNLTVWTDAVAARILFDGKTA
VGVQLADGRRAHGSKATILCAGALDTPKVLLLSGVGPKEDLDPLGIHVVHDLGGVGKNLQ
DHLQSLIETRLSKKLLDRDVARDGEPDTGGPWSCLPFGFLKVEENLETEEFHQLDPLTQN
YLKGATVPQLSLGTAAPLFGRGRTFPDVSYYHVYVNCLMNPQSRGEVRLRSANPADPPFF
DFNALSHPYDLRSYVNNTRRVMELIEGQANAEYFAGYINGPASKSDRDIESWLKAVSGPQ
FHATGTVMMGKAENKLACVDSDFQVFGLENLYVADLSVCPTTPCCMTQSTAYMVAETAAG
TLIEKFGLEQ

Enzyme Prediction     

No EC number prediction in PV07_10231-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	543	8e-138	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.05e-103	1	539	4	530	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.06e-97	1	539	2	528	choline dehydrogenase; Validated
274888	Rv0697	1.75e-71	6	539	2	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.23e-34	72	303	13	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.55e-34	401	538	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS48722.1|AA3_2	5.00e-140	1	547	1	564
QSS73506.1|AA3_2	7.98e-139	1	547	1	564
QSZ30159.1|AA3_2	1.05e-123	3	550	7	589
ATZ54666.1|AA3_2	7.18e-123	3	549	7	573
SMR50493.1|AA3_2	1.11e-121	3	548	6	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.39e-57	4	539	1	558	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.27e-57	4	539	2	559	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	5.57e-50	4	546	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6F97_A	2.14e-47	5	543	6	528	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	2.95e-47	5	543	6	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WWW2|ALKJ_PSEPU	3.30e-68	4	545	1	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	7.93e-67	2	539	4	532	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	6.15e-66	3	539	39	568	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q00593|ALKJ_PSEOL	1.09e-65	4	549	1	534	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|B4SHV9|BETA_STRM5	2.21e-65	3	539	5	532	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998647	0.001377

TMHMM  Annotations     

There is no transmembrane helices in PV07_10231-t44_1-p1.