CAZyme Information: PV07_09973-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_09973-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	KN847045.1|CGC7	65462.48	6.7714

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847045.1:1073943-1075823(+)

Full Sequence      

MAGSRERSFDFIVVGAGNSGAVVAGNLARAIPGPSVLLVERGGDNQDPELRVASERFTNV
YINDAVKLRYETVPQKNLNNRSLEYLRGQGLGGSSMANFCGYIRGSRSDYDTWAEMVDDD
AFKWKNVVQRYCELENLHFTPDDDPDGFVRLRDGVHGFEGPVDLSLAARQEWPTGLDKVM
KASLQFGWPLNQDQNSGDLIGVGSISTTTYKGYRVTSASAYLSNPPANLTIWTHALATKL
LFEKYGNSSKPKAIGVELADGRKPRAKNEVILALGTIDTPKLLMLSGIGPKEDLRQLGIP
SLVNLPRLGKDMIDHNYVIVSWGANTELGTSVDRVRNAELVETARKQWRKDRSGQDAWLN
LSNLLAFVKYDPKRSPKTFEELEKLDERTKKWIKHPQTPQIELFLQGTVPEEFDTKNGPE
CFMLGIMSMQPQSRGTVRLASKDPLEMPLIDPNYFDHPYDSRMMIEGVREGFNLIKSTDL
SKYIVGPNLTPASDSDEDILKFLKTYLMPILHPVGTVRMGSSNDHSACLDTDFRIRGVDG
LRVMDLSVCPLITSNHTQATAYVVGQLGWKQLQKEYGLKMTPPQQKL

Enzyme Prediction     

No EC number prediction in PV07_09973-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	566	3.8e-142	0.9806338028169014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.25e-88	5	565	4	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.19e-85	4	560	1	519	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.19e-40	431	565	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.33e-31	8	577	55	582	Protein HOTHEAD
366272	GMC_oxred_N	2.78e-24	79	293	15	207	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	3.01e-128	8	577	4	564
QSS48722.1|AA3_2	1.34e-126	8	577	4	564
QDS72994.1|AA3_2	4.23e-123	9	578	3	558
QDS74375.1|AA3_2	7.81e-114	2	580	4	570
ATZ54666.1|AA3_2	1.62e-112	1	578	1	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.20e-65	9	568	2	557	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.97e-65	9	568	3	558	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	4.50e-60	9	576	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
2JBV_A	1.16e-49	6	566	11	520	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.16e-49	6	566	11	520	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	7.29e-61	5	566	3	527	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q3L1D1|PDH1_AGABI	3.89e-60	6	576	38	593	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.33e-60	9	566	2	521	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.16e-59	6	576	38	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3JLL7|BETA_BURP1	1.59e-59	7	584	4	544	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PV07_09973-t44_1-p1.