CAZyme Information: PV07_09265-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_09265-t44_1-p1
• CAZy Family: GH95
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727		79147.67	4.5639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:3243124-3245468(+)

Full Sequence      

MGCSGQDIFLPVALGQPPNNIEQRGGHPVPRLGIIDVGGPIETNKFYENFVLGSQGSPSF
VMPYSLAWSKGSGNALSWGMAISHLDDDQKHFGPNNTAIPGAPASYYINGLGIQSVILSA
VEFGSNTVLTADSLLAFSANIHLQPSTGSPSVLTMSVVQGMAFITGQYVNLQPAIQSSVF
FRNVAAAGEPKPGIFKYRVTLEDGKLWLIYAIPANGLTPNFQLSSSTLLRGLPNWYGDIQ
IAKLSDDSLESIYDDAAGAYPTAGHISGSAQNTTAQYSLSWSKGGVYSSNTTLLMFALPH
HRESFDSFTQCNVTAIELATTTKGNATAVVSDYWVLEERNLPITLGFAPWRPGNPTDFQG
ANSLSPAALSIIQNVAATEASQNMSVQTNLNSMYYSGKALSKFAQLVYTMHDLANQQDLA
NAALLELESCFEVFADNQQQYPLIYDTDWKGLVSSASYVTGDPGVDFGNSYYNDHHFHYG
YFLHAAAVVGYLDPAWLNQNKDYVNALVRDVSNPSTLDQYFPVFRSFDWYHGHSWAKGLF
ESGDGKDEESSSEDAMFAYGLKMWGRTVGDASMEARGNLMLAVLARSLQNYFLMTSDNTN
QPAAFIGNKVTGILFENKADHVTYFGTDLSYVQGIHMIPLMPFSTLTRTEQFVTEEWITY
FADGAVRQVIDITGGWKGIVYANLAIINPTAAYNFFTQPSFDMGWIDGGASLTWYIAMSA
LLGGTPS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	35	717	2.7e-219	0.9758842443729904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	27	727	75	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	363	716	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	4.99e-143	27	352	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56325.1|GH81	3.20e-304	4	724	6	723
BAE58039.1|GH81	1.62e-302	4	720	6	719
ABX90783.1|GH81	1.62e-302	4	720	6	719
QRD82801.1|GH81	2.16e-301	4	724	192	909
QMW28320.1|GH81	2.16e-301	4	724	192	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.92e-101	5	704	5	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.21e-100	5	704	30	730	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	7.77e-98	5	704	5	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.67e-27	368	698	319	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.27e-15	473	709	439	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.82e-274	4	720	189	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.69e-191	7	726	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.17e-165	7	719	401	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.26e-162	27	720	66	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	9.34e-150	7	720	427	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PV07_09265-t44_1-p1.