CAZyme Information: PV07_09250-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_09250-t44_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		64215.13	6.2612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:3194154-3196112(-)

Full Sequence      

MVSDGAHFDFIVVGGGTAGNTVAGRLAENANVTILVVEAGVANSHEIDEITTPALAQDLR
SSQYDWAYKTTMVKRDDYERIEKPNTRGKALGGSSALNYFTWVPGCKPTFDRWGEYGGKE
WTWDHLVPYLRKSATYHDDPKLYLPELKKIGGGGPIPISHAELVEEMAPFRDAVIKAWKS
RGEPVNENIYDGELYGLTHCCDTIYKGVRSGSYLFLRNKPNVTILPLVHSKRLIIDDADK
TCKGVTVIDPTGRELNLYANREVILSQGVFESPKLLMLSGIGPARELEKHGIPVIVDSLH
VGQNLIDHPGVPFVLQVKDGYGLEDHLVRKGPKQEAAISSYKKDHSGPMGSGLLELVGFP
RIDKYLEKDPQYQKAKAANGGRDPFSPEGQPHFELDFVCMFGPAFQWHFPTPKHGNYITI
VVDLVRPISDPGEVTLNSADPLVQPNINLNFFADDLDIIAMREGIRFTYDVLTKGDGFKD
IVVKEYPWEMPLDDEKEMHRAVLDRCQTAFHPCGTNRLSKNIGQGVVDPQLRVHGIKRLR
VADASVIPVIPDCRIQNSVYAVGEKAADLIKADHHDLF

Enzyme Prediction     

No EC number prediction in PV07_09250-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	573	2.8e-148	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.20e-87	1	574	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.31e-85	7	571	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.51e-39	427	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.67e-24	87	309	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.50e-23	3	563	49	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85434.1|AA3_2	0.0	1	578	1	578
UDD59638.1|AA3_2	0.0	1	578	1	578
QMW42855.1|AA3_2	0.0	1	578	1	578
QRD89697.1|AA3_2	0.0	1	578	1	571
UPL02484.1|AA3_2	0.0	1	578	1	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	3	578	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	3	578	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	3	578	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.70e-67	8	573	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.43e-67	6	573	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|V5NC32|PDH1_AGAXA	3.51e-58	7	575	40	600	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	9.33e-58	8	570	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|M5EAX2|GMCH_MALS4	1.25e-56	4	570	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.25e-56	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q988C9|4PADH_RHILO	2.24e-56	8	570	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000019

TMHMM  Annotations     

There is no transmembrane helices in PV07_09250-t44_1-p1.