CAZyme Information: PV07_09141-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_09141-t44_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		34137.95	6.5876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:2842337-2843624(-)

Full Sequence      

MSSGAQAKGIWVSVMVGCCGRRRTKKVQENHPAAENTITTSSVAQTSSVENPGGHEEVIA
DGHKWLVPGVGSFGNRAVYTFEGHSLPEGLTKSNYTIRCKNSGDIPFNKRFDPANVRCSK
GYLRLAVPGGQKPSKQTGYAVSCAEVTTVEEKILYGSFRTTAIFSAEPGTCHGIFFYKSD
TQECDIEYVTDPASLSNNGPDNPIPLWYTNQALDPTKVDKSCESGPAPSNCTAHTHEYRI
DWTADFTAFYIDGVCQKNFTNNIPNVPGQLVWNNWANGDKGWAAGPPNRENVFKIQKIVM
YYDTAPNESGDSG

Enzyme Prediction     

No EC number prediction in PV07_09141-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	122	301	1.4e-39	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.68e-34	79	301	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185692	GH16_fungal_CRH1_transglycosylase	3.89e-05	153	288	45	184	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.84e-04	226	277	95	157	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62486.1|GH16	3.12e-70	56	305	31	263
CEI62369.1|GH16	1.25e-69	38	305	16	263
CZS81947.1|GH16	1.46e-68	62	305	38	264
CEF78656.1|GH16	1.46e-68	62	305	38	264
QPC59862.1|GH16	2.07e-68	62	305	38	264

PDB Hits     

PV07_09141-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALQ5|CRH11_ARTBC	7.46e-06	226	292	147	224	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999363	0.000684

TMHMM  Annotations     

There is no transmembrane helices in PV07_09141-t44_1-p1.