CAZyme Information: PV07_08928-t44_2-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_08928-t44_2-p1
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		102529.76	8.0157

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:2065375-2068362(+)

Full Sequence      

MAVATTNGDLPGLWDESRQLGQLFMMGFDGTSVTDQVKVLIEKYHVGSILLKAQNLKSAQ
QATQLVLDLQTLARQAGHPVPLLIALDQENGGVNSLYDEVYIRQFPSAMGLAATGSKKLA
KDIARATAQELNSCGINWILGPVLDVLTNARNQPLGVRSVGDDPHEVSAYGVECIKGYQE
GGVATCGKHFPSYGNLEFFGVPDDVPTITDSLENLSQSALVPFRAAIAHGVDSMMVGGVA
MASSQVNVMHACLSEQIVRDLLRHEMRFEGVVVSECLEMEALSRNIGISGGTVMAFKAGC
DLILTCRTLSVQEDAINGLTAGLDNGMIERYRVQESVQRILNMKKKYTSWERAFAPAGIE
NLSRLQPLHTSLSTTAYNKSITVVRDQKHYLPLSRVIKPDEELLLLTPLVKPLPASALFH
LLQNEASTVPHLGRSPSIDTNTSIMSGEQVFRELGRMLARYRNGKISHTSYTANGVRPLH
ENLLNRARGVVVVTADAGRNMYQNAFAKHISMLCKLSVGVDGTPREKPCVVVAVSSPFDF
ASDTSIGTYICTYDFTETALQALVQVLYGELTPSGVLPGSFSQKPQTSHTRQQWLVESFS
EDRDSAALDALLLQTQNEPSVHAATLKNALSSTFLLRDPDVEEAHFVVRNSSTKELFGFC
TTYYFKNSGVGHIGAIIVDPARRRLSIGHSLHDRAVRALLQKKGITKFQLGVRFPHVYLG
IPRLDPMEYKRLRQWFAKLGWNVSLSTPVATMLIRDLSTWIAPEGLAQALTNPEVKYDLV
HGAEYTEVMMEHLKRCARTDVRGVYQMALGNKEGCRIIRAKRASDQSILGSILMCRAESK
IARHIPSLYKQVGTACLSSPVISTLYSDRVSLFQGLVLLGIRQVKKQGLRTLLLDYTRED
VSMNGLKALGFTISNSFEEISSDPVHWTMMSAT

Enzyme Prediction     

No EC number prediction in PV07_08928-t44_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	304	1.3e-56	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.48e-70	19	394	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.16e-66	20	343	6	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.28e-34	25	366	5	323	beta-hexosaminidase; Provisional
185053	PRK15098	2.81e-12	104	344	119	353	beta-glucosidase BglX.
178629	PLN03080	1.07e-08	105	601	114	595	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	18	933	7	924
BCS15461.1|GH3	0.0	11	933	10	931
QGA17051.1|GH3	0.0	3	930	1	949
BAE65506.1|GH3	0.0	10	933	37	961
QMW48185.1|GH3	0.0	10	933	8	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.94e-91	18	788	11	724	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	5.42e-65	18	578	15	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.47e-44	19	578	47	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.91e-44	19	578	21	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.86e-44	19	578	51	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	7.58e-44	19	578	47	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.81e-39	16	578	28	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.06e-34	31	386	49	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0AF74|NAGZ_NITEC	3.45e-27	20	343	3	323	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	4.93e-27	23	325	1	296	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV07_08928-t44_2-p1.