CAZyme Information: PV07_08928-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_08928-t44_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825		90749.31	8.4156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:2065822-2068362(+)

Full Sequence      

MGLAATGSKKLAKDIARATAQELNSCGINWILGPVLDVLTNARNQPLGVRSVGDDPHEVS
AYGVECIKGYQEGGVATCGKHFPSYGNLEFFGVPDDVPTITDSLENLSQSALVPFRAAIA
HGVDSMMVGGVAMASSQVNVMHACLSEQIVRDLLRHEMRFEGVVVSECLEMEALSRNIGI
SGGTVMAFKAGCDLILTCRTLSVQEDAINGLTAGLDNGMIERYRVQESVQRILNMKKKYT
SWERAFAPAGIENLSRLQPLHTSLSTTAYNKSITVVRDQKHYLPLSRVIKPDEELLLLTP
LVKPLPASALFHLLQNEASTVPHLGRSPSIDTNTSIMSGEQVFRELGRMLARYRNGKISH
TSYTANGVRPLHENLLNRARGVVVVTADAGRNMYQNAFAKHISMLCKLSVGVDGTPREKP
CVVVAVSSPFDFASDTSIGTYICTYDFTETALQALVQVLYGELTPSGVLPGSFSQKPQTS
HTRQQWLVESFSEDRDSAALDALLLQTQNEPSVHAATLKNALSSTFLLRDPDVEEAHFVV
RNSSTKELFGFCTTYYFKNSGVGHIGAIIVDPARRRLSIGHSLHDRAVRALLQKKGITKF
QLGVRFPHVYLGIPRLDPMEYKRLRQWFAKLGWNVSLSTPVATMLIRDLSTWIAPEGLAQ
ALTNPEVKYDLVHGAEYTEVMMEHLKRCARTDVRGVYQMALGNKEGCRIIRAKRASDQSI
LGSILMCRAESKIARHIPSLYKQVGTACLSSPVISTLYSDRVSLFQGLVLLGIRQVKKQG
LRTLLLDYTREDVSMNGLKALGFTISNSFEEISSDPVHWTMMSAT

Enzyme Prediction     

No EC number prediction in PV07_08928-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	196	8.4e-49	0.8379629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.23e-51	1	286	87	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.59e-46	1	235	92	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.12e-26	9	258	96	323	beta-hexosaminidase; Provisional
185053	PRK15098	1.06e-10	1	236	124	353	beta-glucosidase BglX.
178629	PLN03080	4.95e-08	48	493	169	595	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS50503.1|GH3	0.0	1	825	1	827
QSS62698.1|GH3	0.0	1	825	98	924
QSS74235.1|GH3	0.0	1	825	1	827
BCS15461.1|GH3	0.0	1	825	108	931
BCS03847.1|GH3	0.0	1	825	90	913

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.41e-68	1	680	100	724	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.53e-47	1	470	103	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.85e-30	1	470	142	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.78e-30	1	470	116	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.39e-30	1	470	146	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7WUL3|NAG3_CELFI	3.96e-31	1	470	109	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P40406|NAGZ_BACSU	9.53e-30	1	470	142	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q5FA94|NAGZ_NEIG1	2.86e-23	5	228	100	319	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
sp|B4RQ67|NAGZ_NEIG2	3.10e-22	12	228	107	319	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	4.36e-22	1	278	126	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PV07_08928-t44_1-p1.