CAZyme Information: PV07_08925-t44_2-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_08925-t44_2-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		57014.18	7.4511

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:2058303-2059922(-)

Full Sequence      

MDDRVLDLKQWLSLLGGELDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEY
DCKIWESMGAKGWTFPMFMRVLNKLRNTVQPVHARHRNQLCKDWVQSCSTAMNIPIVHDF
NAHIAGTGALRECVGFFSVSYNPDDGRRSSASVAYIHPILRGEEHRPNLKILTNAWVSKI
NVRDDTVTGVNITLQSGQKLTLTARTETILCAGAVDTPRLMLLSGLGPAQELSSLSIPVV
KNIPGVGENLLDHPETIIIWELNRPVPPNQTTMDSDAGIFLRREAPDAAGTKATPTNPAA
IPDGNIADVMMHCYQIPFCLNTTRLGYDTPVDAFCMTPNIPRPRSRGKLYLTSSDPSVKP
ALDFRYFTDPEGYDAATFVFGLRAARKIAQQSPFKEWIKREVAPGPQIQSDEALSEYARK
VAHTVYHPAGTTKMGDVRQDDMAVVDENLKVRGLKGLRIADAGVFPAMTTINPMLTVLGV
GERCAELVAIEAGWRLTEVEMSGRGWANDTGLRARL

Enzyme Prediction     

No EC number prediction in PV07_08925-t44_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	489	7.3e-115	0.9225352112676056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.83e-89	16	493	59	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.46e-84	20	488	64	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.39e-40	343	484	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.81e-24	146	481	218	569	Protein HOTHEAD
366272	GMC_oxred_N	7.80e-22	39	255	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64559.1|AA3_2	1.70e-301	1	495	53	536
ATQ35968.1|AA3_2	3.79e-298	1	495	53	536
QRC92500.1|AA3_2	5.59e-298	1	500	53	541
QGA17054.1|AA3_2	1.54e-297	1	495	53	536
CAE7217204.1|AA3_2	2.27e-297	1	495	53	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.57e-105	2	488	48	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.21e-105	2	488	48	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	6.19e-105	2	488	48	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4UDP_A	1.67e-42	8	492	54	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	5.97e-42	8	492	54	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	8.07e-105	2	488	48	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	4.24e-58	27	489	71	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	6.25e-55	14	488	54	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	6.25e-55	14	488	54	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	6.25e-55	14	488	54	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV07_08925-t44_2-p1.