CAZyme Information: PV07_08925-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_08925-t44_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		62468.39	6.8471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847044.1:2058303-2060133(-)

Full Sequence      

MTTNHLDVSEVDSYDYLIVGGGTAGCVIASRLAEYLPQKKILLIEAGPSDFMDDRVLDLK
QWLSLLGGELDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKIWESMG
AKGWTFPMFMRVLNKLRNTVQPVHARHRNQLCKDWVQSCSTAMNIPIVHDFNAHIAGTGA
LRECVGFFSVSYNPDDGRRSSASVAYIHPILRGEEHRPNLKILTNAWVSKINVRDDTVTG
VNITLQSGQKLTLTARTETILCAGAVDTPRLMLLSGLGPAQELSSLSIPVVKNIPGVGEN
LLDHPETIIIWELNRPVPPNQTTMDSDAGIFLRREAPDAAGTKATPTNPAAIPDGNIADV
MMHCYQIPFCLNTTRLGYDTPVDAFCMTPNIPRPRSRGKLYLTSSDPSVKPALDFRYFTD
PEGYDAATFVFGLRAARKIAQQSPFKEWIKREVAPGPQIQSDEALSEYARKVAHTVYHPA
GTTKMGDVRQDDMAVVDENLKVRGLKGLRIADAGVFPAMTTINPMLTVLGVGERCAELVA
IEAGWRLTEVEMSGRGWANDTGLRARL

Enzyme Prediction     

No EC number prediction in PV07_08925-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	540	3.4e-136	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.01e-105	13	544	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.86e-102	13	539	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.97e-40	394	535	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.45e-30	13	532	55	569	Protein HOTHEAD
366272	GMC_oxred_N	7.21e-22	14	306	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64559.1|AA3_2	0.0	2	546	3	536
ATQ35968.1|AA3_2	0.0	2	546	3	536
QGA17054.1|AA3_2	0.0	2	546	3	536
BCS21375.1|AA3_2	0.0	2	549	3	539
BCS03844.1|AA3_2	0.0	2	546	92	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	6.99e-119	14	539	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	9.86e-119	14	539	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.77e-118	14	539	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4UDP_A	5.19e-55	14	543	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	1.92e-54	14	543	6	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	3.60e-118	14	539	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	7.34e-70	10	540	3	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	9.66e-68	14	539	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	2.01e-65	8	539	1	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	6.39e-65	13	539	4	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000007

TMHMM  Annotations     

There is no transmembrane helices in PV07_08925-t44_1-p1.