CAZyme Information: PV07_08309-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_08309-t44_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938	KN847043.1|CGC8	105320.55	5.6190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:5767700-5770667(+)

Full Sequence      

MDENNSERLNHLDSQHVPSSSTQAPTIVIGNASQAMTSTFNLSMVPSPPATPDSSSEARP
ASSSSATARPTASRHDSSRRTLLYPEGDFRNSSTPELRDLKTDMMCNWLHQQQLERMWST
NGIEEGVMLKKAKNDYKCAPEDLRSRPEGVYDAVRRLNVKCAMTVNTGIVKLFLRDQTLT
HMPLDSGLRLQILPSISHLPDCQKHQFAAFIRTYNILIVWDDDPNHILKRVQSIEDQLIN
MIWKEECEDDESSAPLPSAMPSTLNLNNTNDEETSSQNIEAINALPPRRVVLVQPLLTAI
TMILLVAAIGSGWRQIAIEMKVDHSWTRLAFIAVVPLQCWLALFFMQSVAGCCAQIIGPI
SQMNANTKFYSGMPPPRLPTDGSYTLPHVTIQCPVYKEGLWSVIDPTIKSIKAAISTYEM
QGGTANIFINDDGMQLIPTEQAQERRDFYDEHNIGWVSRPKHEPKPADPSQRPFIRAGKF
KKASNMNYALNVSARVEDKLLTIVRPDDGSWTAEQEREVYNEALASIVTEDEGRTQAAGN
IRVGDYILLIDSDTRVPQDCFLSAVSEMEVSPEVAIIQFASGVMNVTDSWFEKGITFFTN
LVYTAIRYAVSNGDVAPFVGHNAFLRWSAVQDVAYVYEDINDGIVKGKYWSEATVSEDFD
MALRLQTSGYILRLAAYAGQGFKEGVSLTVYDELARWEKYAYGCSELIFHPFAEWFTKGP
FTPLFRNFIRSSMPFHSKLTIMAYIGTYYAIGSAWILTLLNYCIIGWFNGHLDHYYIDSF
KIYFAIIIVFTALGNLALAVMRYRVEDQTLLSALWENFRWIPLLTIFLGGISLHVSQAIL
SHLFSVDMSWGATSKEATDTSFFKEIPTILRKFRFTFIFCAVMSLGMIVVAGIGPLGKLV
PYDWQIGWFTAVWPLATVVGSHALLPLVLNPGLMQFTF

Enzyme Prediction     

No EC number prediction in PV07_08309-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	546	764	2.2e-54	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.38e-50	546	768	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	9.48e-12	544	874	138	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.81e-11	394	658	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	2.18e-06	387	680	1	222	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224137	GT2	5.82e-06	543	678	84	215	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO15800.1|GT0	0.0	78	938	49	888
USW53192.1|GT0	0.0	78	938	48	888
SMY19115.1|GT0	0.0	68	938	35	883
SMQ45410.1|GT0	0.0	68	938	35	883
SMR43958.1|GT0	0.0	68	938	35	900

PDB Hits     

PV07_08309-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

PV07_08309-t44_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

Start	End
291	313
326	348
744	766
779	801
821	843
875	897
907	929