CAZyme Information: PV07_07784-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_07784-t44_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1492		167218.25	4.8900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:4132487-4137025(+)

Full Sequence      

MRTSNIPWTWALLPLLSWDSFVAPARASPSVNVALQASFSAGPYLVELLETAALENSSSY
FPLLDRIADGAFADLQTEQELYTRFLNILQEDGHLSTPESLSSFKFALALHAAAPRVEAH
FQYYTTSIQPHLMAAQDAACPVWVYLDGEQYCSPALDRAQQPVSIPDTVNDLPFDRVLGA
SSDGLPSILYADITHPLFGQFHSVVSQTAREGRSTYKVRYRPSASASHNPIHVTGYGVEL
VLKRTDYIVIDDRDAQKPEDATPDQQSLETVKDDELKDLRPLTTSEVANLGVNAASFILS
SSNPLDTLLQVTSDFPKYSSLLAAANASREFILEHRANREQFLPSGYNVLWINGVQIEPR
QINAYSLLDHLRRERRIIAELKNLGLTSSEAISLLSSEIIAEAQANETPQRFDWRDDSEA
GGVLMWLNDLEQDRRYAGWSSSLRSLFQRTYPGQLPQVSRDIHNLIVPLDMGNIKDIELA
ATSLQSLVRRQVPIRIALIPTGDGETANTYSKVAYYISDTYGLTALMSFFSDVVASKKLD
ASPEKSFNTAIKGRATRPEKEPLSFQDVLTDESLHLRLQARDEYLKRLALAGPNPPFLVN
GVVLPRTDNWFELLSARLYSDLQLVQQAVFQEAISEDSWIPEFFLFQAVKRRNEIVFPDD
PKDTEIVDVGQVTAKFADSFARLPRLPGTEATLLSDRAHLLIVIDLESETGRALLLEAML
FHQRNAETELLIIHNPSPETQSSTFAPGLYALLQEGGRDLTVERLEELLKGDLNSFTDDL
TDASAEFWRSQADLIRTLSLAEGQNGLWLNGRLLGPLEQRFTSVDFESLLEFERRERIAP
VTTAITGLALEDRFTGALDLAKITSLVARSLKSDLPEGLRESAPLIRLERFKIWNGTHTS
IKISNSDDINIQIVAAIDPASELVQQWVPILQTLSQLSGVSVQIFLNPKDRLTELPVKRF
FRQVISAEPSFDAHGSLVIPNASFSGIPRDTLFNLGMIVPPSWLVAPKQSIHDLDNIKLS
NVAEGENIDAIYELEHILIEGHARDVTNGPPPRGVQLMLGTEDEPHFTDTIVMANLGYFQ
FKTNPGYWQISLKPGRSSKIFHIDSVGPHGYSAQPGDETTSVALLSFQGLTLFPRLSRKP
GMEDEDVLESSALGGAMDYLSRGASFASSALSSLGFKKTSTNADINIFSVASGHLYERML
NIMMVSVMKHTKHSVKFWFIEQFLSPSFKSTLPVLANHYGFDYEMVTYKWPHWLRGQKEK
QREIWGYKILFLDVLFPLDLDKVIFVDADQIVRTDMMELNRVDLKGAPYGFTPMCDSRTE
MEGFRFWKQGYWETYLRGKPYHISALYVVDLKRFRQLAAGDRLRQQYQALSADPASLSNL
DQDLPNHMQHTLPIHSLSQEWLWCETWCDDASLAKAKTIDLCNNPLTKEPKLERARRQVP
EWTLYDEEIAGVIGAAKKKQGSTVADNGDLGEAAGDESQRKLVNDDRIRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1185	1432	3.4e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1185	1432	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1185	1452	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.59e-85	412	656	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	2.75e-66	1040	1149	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408199	Thioredoxin_12	2.80e-58	43	228	3	184	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39488.1|GT24	0.0	9	1492	10	1495
CAS97678.1|GT24	0.0	9	1492	10	1495
BCR94558.1|GT24	0.0	9	1452	10	1455
BCS07152.1|GT24	0.0	9	1452	10	1455
UDD64319.1|GT24	0.0	14	1472	7	1476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1460	7	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1460	7	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	30	1150	5	1125	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	27	1460	7	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	27	1460	7	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.54e-283	27	1459	18	1431	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	1.03e-236	31	1467	30	1522	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	6.35e-235	2	1449	17	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	4.80e-234	2	1449	17	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	4.46e-231	28	1449	44	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999761	CS pos: 27-28. Pr: 0.9323

TMHMM  Annotations     

There is no transmembrane helices in PV07_07784-t44_1-p1.