CAZyme Information: PV07_07744-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_07744-t44_1-p1
• CAZy Family: GH5
• CAZyme Description: chitin synthase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914		102405.97	8.4093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:4010706-4013563(+)

Full Sequence      

MASQYPGGYDNGHQLNDIPPGNAYRPTEQHSDDEAEHSLLHQNAAYQSQYDDPHSRPLTP
GQESIYTLNETYVGGDKSQAPITGYNPQHTQPYGREGGYGLSNTQAGFPTPGYPDPTQRS
NSTEAWQQRQAPGFGSVKRYATRKVKVVNSVLSIDYPVPSAIQNAIQSKYRTDLEGGSEE
FTHMRYTAATCDPDDFTLKNGYNLRPAMYNRHTELLIAITAYNEDKVLTARTLHGVMQNI
RDIVNLKKSEFWNKGGPAWQKIVVCLVFDGIDPCDKNTLDVLATVGVYQDGVMKKDVDGK
DTVVHIFEYTTQLSVTANQQLIRPNDNDPTSLPPVQMMFCLKQKNSKKINSHRWLFNAFG
RILNPEICILLDAGTKPGSKALMALWEAFYNDKDLGGACGEIHAMLGRGGVFGRKLLNPL
VAAQNFEYKISNILDKPLESSFGYVSVLPGAFSAYRFRAIMGRPLEQYFHGDHTLSKRLG
KKGIEGMNIFKKNMFLAEDRILCFELVAKAGSKWHLTYVKASKAETDVPEGAAEFIGQRR
RWLNGSFAASIYSLMHFSRMYKSGHNIIRMIFFHIQMIYNIVSVVLSWFSLAAFWLTTKI
IMDLVGQPSSNNNDHAFPFGNSATPIINTVLQYAYLAFLLLQFILALGNRPKGSKVAYII
SFCVFAVIQLYVIVLSMYLVVKAFTSKDGTDIVTNEGANEFIKSFFASTGPGIVIIALAA
TFGLYFVASFLYMDPWHMFTSFIQYLLLMPSFINILMIYAFSNWHDVSWGTKGADKADVL
PSAQTKKDEKGKATVVEEVDRPQADIDSQFEATVRRALAPYVPPVEKEDKTLEDSYKNFR
TRLVATWIFSNALLSVVITSDSVDNFGFTSRATSRSSHFFQALLWTTAALSVVRFTGCCW
FLGRTGLLCCFNRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	222	389	5.9e-71	0.9877300613496932
GT2	366	641	2.5e-20	0.4952561669829222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.33e-97	222	389	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.08e-92	217	549	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	9.81e-34	144	220	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	4.65e-26	338	685	115	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	7.49e-18	355	770	187	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC35278.1|GT2|2.4.1.16	0.0	1	884	1	881
QSS72269.1|GT2	0.0	2	914	5	905
QSS55964.1|GT2	0.0	2	914	5	905
ABQ88371.1|GT2	0.0	2	914	5	905
QSS61035.1|GT2	0.0	2	914	5	905

PDB Hits     

PV07_07744-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00757|CHSB_EMENI	0.0	9	914	16	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P30602|CHS3_EXODE	0.0	1	884	1	881	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	0.0	10	914	16	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|P30598|CHS1_USTMA	0.0	57	913	72	918	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|Q92197|CHSC_ASPFU	0.0	124	914	106	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

Start	End
570	592
626	648
658	680
705	727
742	764
843	860
880	902