CAZyme Information: PV07_07496-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_07496-t44_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		50314.46	4.4568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:3242913-3244352(-)

Full Sequence      

MIRFLISVTIALVSFLSQNAASIALNVDDTQSILEAASLTARGVIDLYNGNQTGGILGKW
PFPPYYWWESGGAWGGLMEYWHYTGDDSYVNVTQQGLIAQLGPRYDFNVPAEAFDTGNDD
QAFWVFVAMSAAEYSFPQLAAPYPSWLQIVNNAWEDYVSRWNSSLCNGGLKWQFNPSNAG
YYYKNSVSNGAFFQLSARLARFTGNQTYVHWADTIWDWASGIGLVDNIYNVFDGTDELIN
CTGVDHHQWTYNVGVFLYGAAVLQNYTNGSSPWIERTAGLLDSTNTFIGPFRNASNVLFE
AECELSMTCNVDQLSMKAYLVRWMAATSKMAPFSAGRIGEVLRASAQGAAAACTGGASNN
TCGSKWYIEGWDGTSGLGQQLSAMEIMYALLVNQTNPPATYPNVSILPAPPSPTITVSAT
ESLPTASGVARPLHDGAALIQSKAQNKIRPLVAALFTSLAVM

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	398	5.4e-87	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.31e-137	32	384	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.75e-07	119	267	93	225	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76159.1|GH76	2.12e-178	10	436	4	430
CCD44408.1|GH76	1.06e-127	22	400	23	395
ATZ53339.1|GH76	2.13e-127	22	400	23	395
QDS74953.1|GH76	1.43e-126	16	396	13	396
APA11655.1|GH76	6.87e-126	24	400	23	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.75e-88	27	400	30	412	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	1.22e-109	11	424	10	419	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	4.71e-104	6	392	3	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.84e-99	12	400	8	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.35e-99	25	398	21	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	9.12e-97	13	387	12	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000289	0.999692	CS pos: 22-23. Pr: 0.9028

TMHMM  Annotations     

There is no transmembrane helices in PV07_07496-t44_1-p1.