CAZyme Information: PV07_07433-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_07433-t44_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	KN847043.1|CGC25	51730.59	4.4256

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:3071561-3073161(-)

Full Sequence      

MKRANMRNLVVSAFAAGASAWTYAPNITYSAAISIDASQKYQTMIGGGCSGAFGIACQQF
GSVGLSPANQEMVTQVLFDENIGGLTIVRNDIGSTPGHVRGDVASILPVCPPTPEGPFNY
VWDRNDTCQLQLTQTALKYNPNVYVYADAWSAPGCMKTVGTEDEGGLICGVRGSSNCSGD
WRQAYADYLVQYVKFYEQEGIEVSLLGAYNEPDFNPVTYACMESDGYQAKDFLEILYPTA
KAAFPNISVACCDATGARQERNILYELQQAGGADLFDVATWHNYQSNPERPFNSNGKPNL
MTEWADGSGPWNANWDVSGQLAEGFQWAMYMHNAFVNSDTSGYTHWWCAQNTTGDNALIR
LDYDAYFVSARLWAFAAYFRFARPGAVRVGAASSAENVYVSAYVNANGTVAVPVINEAHF
PYQLTVHLGGGIDASTATAYLTDNQHNVTMVGQTPIGGGGVFEATIEPRAVKTFFLS

Enzyme Prediction     

EC	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	31	474	4.6e-159	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	8.05e-21	30	474	33	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	1.49e-10	65	381	19	332	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	8.93e-05	385	474	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57081.1|GH30_7	4.36e-254	19	476	16	464
UKZ82812.1|GH30_7	4.36e-254	19	476	16	464
UKZ94643.1|GH30_7	6.19e-254	19	476	16	464
AAV25955.1|GH30_7|3.2.1.-	8.79e-254	10	476	7	464
AAP64786.1|GH30_7|3.2.1.-	8.79e-254	10	476	7	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	3.06e-90	31	474	22	469	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.98e-89	33	474	95	540	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	3.59e-78	33	476	5	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	6.16e-77	33	476	12	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	3.20e-72	33	477	25	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	4.67e-78	33	476	29	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q45070|XYNC_BACSU	7.51e-08	129	477	97	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|O16580|GLCM1_CAEEL	1.58e-07	33	417	87	482	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.033323	0.966632	CS pos: 30-31. Pr: 0.8008

TMHMM  Annotations     

There is no transmembrane helices in PV07_07433-t44_1-p1.