CAZyme Information: PV07_06776-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06776-t44_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		64763.29	6.1296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:1090601-1092501(-)

Full Sequence      

MVHPATAPKGAPQAFDFIVVGGGTAGCVVAGRLAENPKVSVLVIEAGINNTNEIPEIFTP
ARAFELRGSQYDWGYKTTMINRPDYTRVEKPNTRGKMLGGSSGGNYYTWVRGSAATFDDW
AEYGTDEWNWENTKAYFNKSTTYHDDDNLYPTDLAKIGNQGGPLHISHSDLIPELKPFRD
ALEKAWVSKGQELTTDVYSGTQKGLFKCVNSIYKGRRSTAAVFIEGKDNVTLMSSTISKK
IVFEGNKAVGVTVIGPDGQDYTFRAKYEVIVSQGVFESPKLLMLSGIGPKEHLESKGIKT
LVDSPHVGQNLLDHPILSHVFKIKDGFGLDSHLLRAGPQKDGAIAAYRKDRTGPYSSGLL
ELVAFPRADEWFETSKEYREYKAKNGGVDPFGPAGQPHFEVDFVPMFCDAFQWHFPTPPQ
GDYLTVIVDLMRPLSRNGEVRLNSTDPTEQPYVNINFFSHDLDLVALREGVRMIDDIVMH
GEGMKDLIEGDYPWALPRNSDEAMIRQILERSQTGFHPCGTARLGKDIAQGVVNPKLQVH
GAANLRVIDASVFPVIPDCRIQNDVYMVAEKGADLIKAEYPGLYK

Enzyme Prediction     

No EC number prediction in PV07_06776-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	578	6.9e-154	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.57e-105	13	577	4	532	choline dehydrogenase; Validated
225186	BetA	1.79e-92	15	581	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.75e-42	433	571	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.30e-28	4	568	45	568	Protein HOTHEAD
366272	GMC_oxred_N	1.34e-25	94	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24176.1|AA3_2	0.0	1	585	1	585
AFR94515.1|AA3_2	0.0	1	585	1	585
KGB80031.1|AA3_2	0.0	1	585	1	585
UOH84707.1|AA3_2	2.17e-313	1	585	1	568
BCS02092.1|AA3_2	6.20e-301	13	585	7	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.36e-253	15	584	7	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.72e-253	15	584	7	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.92e-252	15	584	7	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.05e-66	15	579	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.63e-66	15	579	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	2.26e-68	13	582	5	539	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.40e-63	15	577	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	5.60e-63	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	4.07e-62	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	4.07e-62	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999907	0.000130

TMHMM  Annotations     

There is no transmembrane helices in PV07_06776-t44_1-p1.