CAZyme Information: PV07_06600-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06600-t44_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41366.99	6.2858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847043.1:616782-617935(+)

Full Sequence      

MAISHSWRRATLAAFVLLTLFFLLRHASLSPSIPLVEGAAEGGQPSRPYPPPKSPKVVQE
TQQAVQDVAGKPLRERLRYHFPYDIEAKFPAYIWQTWKYGPDSGNFEERLRPFEASWSHL
HSGFVHEVVTDDAALHLINYLYASMPEIIQAYEAMPLPVIRADFFRYLILLARGGIYSDI
DTQALQSATEWLPQTLDKSTVGLVVGIEADPDRPDWNEWYARRIQFCQWTIQAKPGHPVL
RDIVATITEDTLAMKKAGQLRRGKEPAKSIMEYTGPGVWTDALFSYFNNQEYFDFSTRKT
NVSYPDFFAITEHKKIGDVVVLPITSFSPGVGQMGSEGPEHPMAFVRHDFDGSWKPENER
MKGD

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	115	194	9.6e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.91e-40	71	355	64	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.17e-17	116	195	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52760.1|GT32	1.94e-152	6	363	3	375
CCD51914.1|GT32	1.94e-152	6	363	3	375
APA11100.1|GT32	2.77e-151	51	363	49	359
QKX63547.1|GT32	9.41e-151	59	363	63	365
QVM11372.1|GT32	1.05e-149	6	355	3	353

PDB Hits     

PV07_06600-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	5.39e-93	73	355	83	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.75e-82	79	355	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.34e-75	73	363	80	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.19e-73	65	355	102	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999791	0.000244

TMHMM  Annotations     

Start	End
12	29