CAZyme Information: PV07_06181-t44_2-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06181-t44_2-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		45283.08	7.1954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:5242331-5243578(+)

Full Sequence      

MDLSPSSRNGNPLQQLYGSRRSLRWIVFLVLAALVIIYMTGSTYEPHSVAGSAGAGTSSS
GHRSSTSGFKHSHKKQAKNLSPVDLMKRPISRDLQTIPKLMHQSWSSTELPAKFERWSAT
CREQHPDWEWVLWTDEDNEELVRTHFPWLLKTYLGLPSVIYRADLVRNLYMYMFGGVYSD
LDVECLRPIDELFAQYNVTTASHGKPKPQSAQNMLKSGRKAFFGRMGTDHGSSNSIPNAW
MASTPGHPFFLIVLESVMKRMTEEGDMDNVEGITGPGKLYDMINEYRQDDSKWAGEALDK
HVSKNPTAKQFNPRKGLKHSIEVLPFQYIYPYSWERDGEAYREVCWATKEEFNPERCKQL
LATDHWPSYVITYWSHTWTSGGHDDGNVQKLEMADQ

Enzyme Prediction     

No EC number prediction in PV07_06181-t44_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	194	6.1e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.25e-27	78	257	64	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.06e-17	120	198	10	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	2.90e-102	76	391	77	410
QLI72987.1|GT32	1.68e-85	77	391	50	358
UKZ71055.1|GT32	3.63e-85	72	393	72	372
ANH56535.1|GT32	2.73e-80	80	391	87	376
BCS29894.1|GT32	3.40e-78	79	378	70	380

PDB Hits     

PV07_06181-t44_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.83e-24	91	192	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	1.27e-20	95	337	53	254	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.05e-20	93	259	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	2.12e-20	97	259	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	5.56e-20	95	297	60	230	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000006

TMHMM  Annotations     

Start	End
21	43