CAZyme Information: PV07_06100-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06100-t44_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714	KN847042.1|CGC21	73362.03	4.1887

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4948460-4950912(-)

Full Sequence      

MPSSSLFLRSSTTLVSALLLLSSSASATNTYYALDTEYSGTNFFDGFNFFADADPTHGFV
TYVDEATAEADGLITFNGGSAQMRVDHKNPYNGSAPYSGINGVGRPSVRIESIKSWTHGL
FVADIKHMPTTKDGSGCGVWPAFWTLGSGTWPYNGEIDIIEGANNQGTDLTSTHVAGTCV
ISQSPLEMTGTSNGNNCQYDVSTGANAQGCGAFDTSSSSYGSGFNANPGGGGGVYAMEWT
SDAIKIWFFARKSIPSDISSGKPDPSGWGLPASIFDGPGCDIDANFADNRIVFDTTFCGD
FGDATWSSGGCAASTGQSQCSVYVGSNPGDFKDAYWDVNYVQIYQSQPVTTTSTSTTTTT
LVTTTRPLYTHSSSSSETTTPSPVVSTTSPVVPTTTPYVPHTTPSSTAGLPQTTSSRYLS
VGPFYNTTSSSTSGSGSSTWNDWAPTTTSDPVTSTWEDWSDPTTSSVSSSTSSSSSFQWQ
DWTTSTTTPSDPATTWGDWSDEGSVVTVTITKTWTEPCSTGFTTKTTTITTTHCGCTETP
VPTACMTTKTFTPSAGWPFSTPIVASVPCAAPAGTTSPVAATSTAPAPSGTWGSQPVSLA
PTVTEGSWGGKPVSPVAAASTGTGSGAWVSPSVTLATTLTVAPVPSSSAPVAAASKSATP
VAPYSIASNGTWGAAASSTSSWVAPYTGAAGRTTLNAFTAMLAAGAVALGMFAL

Enzyme Prediction     

EC	3.2.1.73:4	3.2.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	72	324	4.9e-78	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	1.97e-134	32	345	2	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	3.81e-16	96	248	55	176	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	2.79e-06	107	174	70	148	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185689	GH16_fungal_KRE6_glucanase	5.06e-04	37	162	8	137	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
236090	PRK07764	8.55e-04	553	632	406	485	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK36992.1|GH16_1	4.05e-95	8	351	5	324
ANC68156.1|GH16_1|3.2.1.73	3.06e-94	8	351	1	321
BCS08185.1|GH16_1	7.12e-92	8	349	1	319
BCR95648.1|GH16_1	7.12e-92	8	349	1	319
QSZ33779.1|GH16_1	3.55e-90	1	344	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	8.98e-77	32	344	3	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	1.71e-76	31	344	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	1.76e-76	31	344	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.24e-75	31	344	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	1.32e-75	31	344	3	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	1.51e-77	32	345	129	418	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	9.97e-72	32	351	20	321	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A2QBQ3|EGLX_ASPNC	1.20e-68	26	346	22	322	Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g00850 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	6.83e-68	32	345	33	328	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|A1DHY9|EGLX_NEOFI	8.65e-68	1	345	1	327	Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_089530 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000574	0.999404	CS pos: 27-28. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in PV07_06100-t44_1-p1.