CAZyme Information: PV07_06070-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06070-t44_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	KN847042.1|CGC22	67580.64	6.0993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4854148-4856207(+)

Full Sequence      

MSARNGVNGHADGSSNALCSVDELVSRKYDFVIVGGGTAGLAVAARLTEDPNVSVAVLEA
GENRMDDKSVSTPSLYPTMIGRKEYDWCMTSIPQPNAGNKVYSMPRGKVLGGSSAINYLM
YVRGSKKDYDGWESMGNPGWGWDDMLPYFKKHQTVDNTPRHSDPQFMPIAGGDKYHGSNG
PIHTSFNDWYMPLEVEFAEAAYAVTGTKKTVHDAWSGDHLGFYSSLGAVNRTDDPGNRSY
AATGYLRPNLRRPNLKVLTEAQATKIILDGDAAKGVEFVHKGQKYRAQATREVVLSAGVI
QSPQLLELSGIGDPEVLRAAGVECVVENKGVGANFQDHVLGGLLYDLKPGIDSMDALHGE
EFMKMQQDVYQNSQKGLFANPGMMMGFVSYASVVTPDELEATIKEIKQKSLAKTDFEKAQ
EKVIVDQLRDPTFANLQTFCIPCRLDVAKGSDQTLFFGKPPNGKQQLSLLMCLEHPLSRG
TVHIRSSDPLAPPEIDPGYFRNEVDAKILAAGMKWMDQVAKHPLLAKSLAERELPPETEN
LDTEEKRVEYVKNHISTQYHLIGTCALGEVVDTDLKVKGVKNLRVVDASVFPGHVSGNIM
ATTYAVAEKGADLIKKDI

Enzyme Prediction     

No EC number prediction in PV07_06070-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	617	1.3e-183	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.21e-120	26	615	3	532	choline dehydrogenase; Validated
225186	BetA	4.31e-115	25	618	4	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.73e-70	30	614	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.79e-40	476	609	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.27e-38	104	338	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21990.1|AA3_2	3.78e-315	9	617	3	613
SMQ51478.1|AA3_2	3.65e-312	5	617	9	619
SMR55931.1|AA3_2	3.65e-312	5	617	9	619
SMY25122.1|AA3_2	3.65e-312	5	617	9	619
SMR53556.1|AA3_2	2.65e-295	5	617	9	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.32e-72	26	617	3	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.97e-71	29	617	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.06e-70	29	617	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.00e-68	25	617	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6ZH7_A	2.87e-64	25	614	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	5.61e-152	17	617	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	5.61e-152	17	617	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.17e-151	20	617	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.13e-101	14	618	25	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	5.26e-85	23	614	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000024

TMHMM  Annotations     

There is no transmembrane helices in PV07_06070-t44_1-p1.