CAZyme Information: PV07_06018-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06018-t44_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		63899.13	6.0721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4719050-4721022(-)

Full Sequence      

MSPVRTVENASEEYTYIICGGGTSGCVIAGRLAEAFPSATSDVSILVIEAGPDSTGHPLI
TMVGGLFQAMGGELDWALETVPQEHLDQRVLQLNRGKFLGGSSGFNGTLCIRGCKADYDD
WELEGWTGDDMFRYMQKAETFHGKAWFKAADGSHGTNGPLHVEPHDTAPISNHVLESLRD
RGLPLVDDMFTTGEAAHACGHVPRTVHDGVRTFSTDYLKGHEDRVDIVVNTVVDKIILES
VGGKVVATGVEVVDGSGKRRVLKAGKQVILSAGAYCSPTILLRSGIGPKEELAQFGIDCK
VDSPGVGKNFQDHLVVFVPYEVTQPNLTNDRFIHHANGLANSLSTYQSSRSGFFSTFPFG
VFALARLGDGLNSSVLWRERSAASPGTTRDAANLTPQQAHVEYMHTELYSGHVHGYPIPL
EGKHGFEMMTLLFSQQSRGTVALRSTNPHDKPVIDPRYLSDPLDLLMLTEGVRFAHSIVT
SGSGTKGIVAPGVWMAGPKYAALGSETTREDWEPYVRQYSATAHHPAGTCRMGKDGDAMA
VVDEKLRVRGVKGLMVADCSIMPSLNGGHTQMPAYAIGEKAAEMLIEASETNV

Enzyme Prediction     

No EC number prediction in PV07_06018-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	587	1.4e-157	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.30e-112	10	584	2	530	choline dehydrogenase; Validated
225186	BetA	1.01e-101	9	589	3	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.76e-61	17	585	4	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	4.02e-44	436	581	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.45e-32	87	315	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB81353.1|AA3_2	1.59e-210	6	587	3	574
BCS07163.1|AA3_2	1.08e-206	12	587	3	567
EAA66972.1|AA3_2	7.34e-206	6	587	3	582
QMW48130.1|AA3_2	1.58e-204	8	587	3	572
QMW36070.1|AA3_2	1.58e-204	8	587	3	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	2.35e-64	10	585	4	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	6.32e-64	10	585	4	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	6.32e-64	10	585	4	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	8.71e-64	10	585	20	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6ZH7_A	1.70e-63	11	585	5	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8UH55|BETA_AGRFC	7.44e-72	16	586	5	526	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|Q8G1Z8|BETA_BRUSU	2.03e-71	13	586	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|A9M9H8|BETA_BRUC2	2.83e-71	13	586	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	2.83e-71	13	586	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	2.83e-71	13	586	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PV07_06018-t44_1-p1.