CAZyme Information: PV07_06016-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_06016-t44_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894		101566.49	5.2712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4710871-4713605(-)

Full Sequence      

MATKQQHGLAAGWKWRLANANGISKADDIPDLKTWTPVTAFPSVVQMELLAKKIIPDPNV
GENERQIQWVGGMDWEYSCSFPTPKGLDNSSIADLVFEGLDTFANVFLNGKEILKSDNMF
IPHRVNVTSQLQPEGQENELSILFESALKKGSELETKFGARKQVIRDKRRSHIRKAQYQW
GWDWGPVLVTAGPYMPIYLETYSARLEDVYITTELAEDHSTATLTIAVQAAGPPAKVAKV
SILDQALSQVSDELEIALDDSKKGSATVTITDPKLWWPNGQGAQHLYNVSVSLMDGSSSQ
LDTKTIRYGIRTIKVIQRPLDNAPGKTFLFNVNGRDIFSQGGNWIPGDNLLPTMTRERYF
DWVRLSQYHHLNMIRVWGGGIYETEDFFDACDEMGMLVWHDYAFACGDYPVHKEFLDSVK
AEAEAQTIRMRNRASLALLCGDNEDFGIQDFFGEPYDFKDHEGPFENSTFPARKIFLDVL
PKLCERLCPAIQYWPSSPWGEEGTNASDTTFGDLHQWAVWHGPQHAYQKYGELSGRFVSE
FGMHGFPIMRTVDVFAPDLKDRHPQSRTIDCHNKGHGAETRIARYLSENFRYDMKLDNFA
YCSQLLQSEAYGYALRDWKRKFGGKGKEECAGAIIWQLNDVYPVTSWAYIDYYLRPKPAF
YTIRRNFAPISVGIERTPRSRWIDEDKPKDSYIPNFALFAHNTTPAEVKCTLQLRAYDLY
GGKEVELDWTGVSSEVTLSAGHNTELGSLKPHASWTEETLVILDASLLDPSTKKVVARFT
DWPEPYRYLQWPVDTKVTVSVQNMKNDHTNTYISDTHFEDVVTVTANQPIKGCWLEPVYD
GNEKQDEPEPLWEDNMFDLLPGQEIEVAVKGLRGRKVNVRFLADWEVGPAKAHL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	714	1.1e-87	0.6582446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.96e-70	39	683	28	643	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.06e-14	77	331	69	288	beta-D-glucuronidase; Provisional
395572	Glyco_hydro_2	5.95e-13	204	311	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	6.91e-09	77	398	113	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
407658	Mannosidase_ig	3.73e-06	695	788	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00148.1|GH2	0.0	13	887	11	880
QRV91212.1|GH2	1.58e-215	30	884	82	924
CEI64504.1|GH2	2.65e-212	31	873	21	839
ATZ49691.1|GH2	6.31e-211	37	882	50	876
UQC87618.1|GH2	8.37e-211	38	882	53	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.76e-124	42	675	49	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.46e-109	35	884	25	836	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.52e-109	35	884	27	838	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.56e-109	35	884	27	838	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.04e-109	35	884	25	836	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	8.37e-211	9	882	9	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q5B7W2|MANBB_EMENI	1.96e-196	1	881	1	838	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q4WAH4|MANBB_ASPFU	1.03e-193	1	881	1	840	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	2.04e-193	1	881	1	840	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	4.26e-192	1	881	1	838	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PV07_06016-t44_1-p1.