CAZyme Information: PV07_05906-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_05906-t44_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	KN847042.1|CGC11	71428.06	5.1353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4305255-4307544(-)

Full Sequence      

MSLRTVWRHIYGESWPIDLSLLPFPSSFLLSVEDSAMYFSGFITAALAGVACATPIEKIK
RQTIQETYDFIIAGGGTAGLVIANRLTECPNTRVLVLEAGPEPGVVANYMYPGGNQYLAG
TAIDYNYYTLPQKNLNNRILPYHRGRGLGGSSAINGLYYGRGSASVYDHWVEIGNQGWGW
DDLYPLSIKQTHFNPPNLNDSFDHSFQTWDPTAYSNGELQIAFQGFVPDSNVGFIRAGEA
IGIPIVNELNNGNNTGVKQGTGCFDSRLRRSSSYDAFYKPIQNRTNLDVLHYASVTSIQF
TKGSNGTSRATGVSFTDQQTGQFITVNATKEVVVAMGAFNSPQLLMISGIGPHAQLSQNG
ITPVHINENVGQNLNDHCVFSIMALVQQTASTSSMAISDSTLEAAEQQFLNSLTGPYTAP
SGITNGFQQLSNATLRAIGAQAVLDAGLVNQSHVEFLYESLFYPSGLAFLPSTGGTSSTG
GASSSAYYVPQSNLSYISLTASPLVALSRGSVTLKSASIFDAPNIDPNYYANDTDRAVAI
NAFKDLRKLLAHPAIAQFTMGPNNGEVQPGLANIPANASDDAIFDYIKANTIPNWHASGT
CQMLPEADGGVVDSRLRVYGVQNLRVCDVSIIPRLPDVNLQGPVFMIGEKSAQVIKEDYN
LQC

Enzyme Prediction     

No EC number prediction in PV07_05906-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	67	658	1.6e-165	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.09e-96	63	658	3	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.93e-96	65	656	3	532	choline dehydrogenase; Validated
274888	Rv0697	2.84e-49	69	655	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	6.55e-42	508	650	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.66e-34	136	379	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49367.1|AA3_2	1.75e-259	64	660	35	611
QSS67839.1|AA3_2	4.98e-259	50	659	20	610
QBZ60141.1|AA3_2	6.20e-254	46	660	9	607
QPC76270.1|AA3_2	4.46e-245	53	660	20	609
CEF73970.1|AA3_2	8.97e-245	39	660	2	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.20e-72	67	658	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.75e-71	68	658	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.01e-70	68	658	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.05e-60	68	660	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	4.47e-59	64	661	2	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.25e-77	40	657	11	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|M5EAX2|GMCH_MALS4	4.42e-69	36	655	8	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.42e-69	36	655	8	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	7.74e-64	42	656	3	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	6.92e-63	66	652	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999301	0.000687

TMHMM  Annotations     

There is no transmembrane helices in PV07_05906-t44_1-p1.