CAZyme Information: PV07_05799-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_05799-t44_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	KN847042.1|CGC5	48604.37	4.9646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:4001818-4003360(-)

Full Sequence      

MLPRTILVGSILQLVTWAASLEMRQSSGGQNTCTIASKYKSSGGKADDSPAVAAAFARCA
ENSTIVFGEGVDYNILQPIVATNLSNVVIQMQGNIHLPRNITAIQEMVNKTTAATNGSAL
YWFNFAGPSINYVGTQNVTNGWIDSYGQAWWDANPKNGSGAPARPHLMSFSTTNGSMKHF
KSRKPIAWGVQVSGKNITISDTVIDAVSATEGFPFNTDGFDVGGSDIRILDSVIFNGDDA
IAVQAGASDILFRGGTIGYQSHGMSIGSLGQNQARWANVSNVRFDDVTVIDAVYAARFKS
WIGGKGLARNVTWSNIRVYNVTFPIFVTQTYVNQGSAQTQIENGTTVGRPNNSTVDMEDF
TWANFTGTINTFNPGDGSCVSDPCWYNVGLPDLQHTEAIIIECNTDSSCKNFALDNIQVF
PETFAPPTVICLNATAALNPGLGFTCANGTYTPI

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	85	436	4.4e-49	0.9015384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.01e-35	110	436	33	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.98e-26	75	433	92	388	polygalacturonase
177865	PLN02218	1.10e-21	122	419	149	408	polygalacturonase ADPG
215426	PLN02793	1.47e-20	141	423	151	398	Probable polygalacturonase
178580	PLN03003	8.11e-20	140	368	120	330	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50475.1|GH28	1.16e-215	32	454	34	456
APA09280.1|GH28	7.48e-213	33	454	30	451
QSZ36348.1|GH28	1.59e-206	50	454	24	428
ABD14402.1|GH28	2.06e-195	33	454	32	438
BCS06604.1|GH28	1.19e-194	33	454	32	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	9.66e-23	93	390	32	326	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	2.96e-22	93	381	24	310	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	2.54e-21	93	390	24	318	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1CZF_A	1.60e-20	93	412	51	356	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1HG8_A	1.40e-17	143	379	81	321	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27UB0|PGXC_ASPNG	2.99e-195	33	454	32	438	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	2.99e-195	33	454	32	438	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|B0XYC4|PGXC_ASPFC	1.01e-188	7	453	8	439	Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgxC PE=3 SV=1
sp|Q4WX94|PGXC_ASPFU	1.01e-188	7	453	8	439	Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgxC PE=3 SV=1
sp|A1D7I1|PGXC_NEOFI	8.25e-188	7	453	8	439	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999629	CS pos: 18-19. Pr: 0.9622

TMHMM  Annotations     

There is no transmembrane helices in PV07_05799-t44_1-p1.