CAZyme Information: PV07_05347-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_05347-t44_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	KN847042.1|CGC8	41241.47	3.9561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:2544917-2546216(-)

Full Sequence      

MNSGILQGNNITMKLSWFAAISIAIALKATPVFPQDEVTTSEITPSEVTSSGVTPSEATP
TEIPPGSDPIPEERSDPVPEQGSEAEVSEEEDDYGTVPHLPEDCSDIRIFSARGSNEPYP
GRGGEMLGVMCSKFEPEGVSCDYEDIVYPANISYSGIYCESANAGAYAGQAQLRDYTQRC
PDSKLILLGYSQGADVVGDMLGGGGGSIFGCDQAWNPSMPRDTVPGSRIAAVVTMGDPRF
TANQPYNIGRGSTYNGTSPRSGQQLADLNVYEDIIAMWCNAGDPVCAVGSEPVNISAHWS
YYDQYSVVASEWVVATVLHHPNVRLDLDLDGHNESVVLTGSKNSTDNNDTVIHSGNSGDE
NKATSLISPSGGGIGLLSTVVLVTAGLISAI

Enzyme Prediction     

No EC number prediction in PV07_05347-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	104	315	2.9e-43	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	9.06e-22	104	315	2	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54783.1|CE5	1.02e-67	103	326	49	279
QGI63982.1|CE5	6.45e-65	104	317	31	234
QGI81251.1|CE5	6.45e-65	104	317	31	234
CCT68028.1|CE5	1.44e-63	104	317	31	234
QBZ64457.1|CE5	1.52e-62	104	318	52	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	4.90e-18	104	313	2	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	1.67e-12	104	313	2	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.67e-12	104	313	2	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.67e-12	104	313	2	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4PSC_A	2.09e-06	104	319	79	249	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	1.21e-16	104	313	33	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.05e-16	104	313	25	225	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P9WP38|CULP3_MYCTO	7.58e-12	96	314	36	223	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|O59893|AXE2_TALPU	1.30e-11	104	313	29	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.38e-11	104	314	44	223	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002938	0.997016	CS pos: 34-35. Pr: 0.9435

TMHMM  Annotations     

There is no transmembrane helices in PV07_05347-t44_1-p1.