CAZyme Information: PV07_04910-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_04910-t44_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984	KN847042.1|CGC4	110784.54	6.3204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:978668-981678(-)

Full Sequence      

MARSSRRMSSWPISYLSILLLLFFVSPAVMVKHHDFKRCDQSGFCKRNRALADSMTEKGS
PESSPYQLDAASIKFKDGRLDGSIIKSLADGDAVKLPLTMTFLDRGNVRVTVDEEKRRKG
EIELRHGSVARKERYDEAAAWALTGAGLQAQTTASMKKVSKDVTEVSWGPSGHFKAIIRH
APFGVELWSGEEKHVVFNGRGFLNVEHWRPKVEKPSVDENNTEAQPAEPTEDESTWWDES
FGGNTDSKPKGPESVAMDITFPGYGHVYGLPEHTGPLSLKETRGGDGNYDQPYRMYNSDV
FEYELDSPMTLYGSIPFMHAHRKSSTVGVFWLNAAETWVDIVKSKHDTNPLTLGLTGGVV
DTHTHWISEGGLLDVFVMLGPTPEDVSKSYGELTGYTAMPASFAIAYHQCRWNYVSDEDV
KDVDRKFDKFNIPYDVIWLDIEYTDDKKYFTWDPLNFPDPISMEKQLDETQRKLVVIIDP
HIKNKDGYFVVDELKSKDLAVKNKDNNIFEGWCWPGSSHWIDAFNPAARAWWKSLFTFDR
FKGTQSNVWLWNDMNEPSVFNGPEITMPRDNLHHGNWEHRDLHNINGMTFHNATYHALLE
RKKGEIRRPFVLTRSFYAGSQRSAAMWTGDNQASWEHLAASIPMILNQGVGGFPFAGADV
GGFFGNPSKELQTRWYQAGAFYPFMRGHAHIDTRRREPYMLGEPYTGIMTQALRLRYSLL
PAWYTAFHEAATDGHPIVRAQYFVHPSDERGFDIDDQMYLGSTGLLVKPVTVEGGESVDV
YLSDDENYYDYFDYTTYAGGSRTHKIDAPLDKIPLLMQGGHIIPRKDRPRKSSGLMKWDP
YTLVVVLDKHGEKAEGTLYVDDGETFDYQQGAYIHRQFSFEGGVLRSSDIGTKGAKTAGY
LKAMKGVKIEKIIVVNAPAAWSSAGELAVSEDGFKGERKVEISYHAATGNKAAWAVVRSP
GMGIGVDWSVKFPESASSAPKTEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	376	823	2.8e-150	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	160	920	71	765	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269889	GH31_GANC_GANAB_alpha	0.0	395	865	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	376	823	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269890	GH31_glucosidase_II_MalA	1.08e-143	395	734	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	1.56e-115	381	902	164	669	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAB8076003.1|GH31	0.0	5	972	4	965
CAK40395.1|GH31	0.0	11	972	5	957
CAS97680.1|GH31	0.0	11	972	5	957
ACF60497.1|GH31	0.0	11	972	5	957
QVM11559.1|GH31	0.0	30	972	1	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	31	972	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	31	972	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	1.52e-246	13	983	16	952	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	4.44e-246	31	970	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	4.59e-246	31	970	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	2.97e-290	34	912	29	881	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q9FN05|PSL5_ARATH	2.04e-251	14	971	3	919	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q94502|GANAB_DICDI	9.35e-250	16	971	10	941	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q8BHN3|GANAB_MOUSE	3.90e-246	2	970	6	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	1.24e-244	2	970	6	941	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999705	CS pos: 30-31. Pr: 0.9695

TMHMM  Annotations     

Start	End
13	31