CAZyme Information: PV07_04846-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_04846-t44_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		51551.96	10.3832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:773994-775367(-)

Full Sequence      

MSKAYREAGARDLIWILDCNVWVGRGVCARMVDRLCGFTRQGHAPTTPYKLVHHLPISVD
VDLHADQGDLRVADSLSLGDGPTTPQTARKLSLGNLSRSERLKRSAGGRVEELFLSSSHA
KMYVAINTVAVAPCILGKSTMFRRVHLDQLTAQKALEEDRSRRSGALQGHHAENTGFQST
RVGIDYFSHNICEDHLIGDLLWKSPVPAAPDVPRKMRNHGLVYGDLAIQPISSMSLQSYM
SRRVRWLRVRKFTVPVATLVEPGTESFLCSLMGAWGLTTFSGTNGWAGNSWGRLWMWWCA
SILCWMAVDWTVYLLLHSGRTIEASGRDRQVETIPSFARPLSAAVRSRRRFPIWLLAWLG
RESLALPIWTWAIWGGTSVTWRDRRFWVGFDMRVHEIRDDKTERRSTDEHAEGRLVEKTN
GHTTTMNGKTNANANMNMNMNMNANGTARRRKEPEGK

Enzyme Prediction     

EC	2.4.1.80:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT21	1	250	1.7e-52	0.6652360515021459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133012	Glucosylceramide_synthase	4.55e-11	1	250	78	196	Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94794.1|GT21	7.55e-128	1	400	161	535
BCS07376.1|GT21	7.55e-128	1	400	161	535
CAL00272.1|GT21	9.68e-128	1	397	123	494
ACP99703.1|GT21	2.65e-127	1	401	119	498
EAA60599.1|GT21	5.22e-126	1	397	226	580

PDB Hits     

PV07_04846-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MS28|CEGT_MAGO7	5.75e-96	1	397	144	476	Ceramide glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10668 PE=1 SV=1
sp|I1RPI4|CEGT_GIBZE	2.74e-85	1	413	138	519	Ceramide glucosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GCS1 PE=1 SV=1
sp|C4R4B3|CEGT_KOMPG	1.16e-46	1	397	163	509	Ceramide glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_0357 PE=1 SV=1
sp|Q5AMQ4|CEGT_CANAL	1.79e-42	12	397	165	544	Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSX11 PE=1 SV=1
sp|J9W453|CEGT_CRYNH	4.50e-27	12	386	142	435	Ceramide glucosyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
252	274
294	316