CAZyme Information: PV07_04705-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_04705-t44_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44395.27	6.1412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847042.1:257145-258384(-)

Full Sequence      

MLSAAGIRLRLTATIALITIVLFFASFRVLNPEAHELFELQEDIPPILDHAQAKSTVKSS
QNSESIYEIYNETLGFQKIYMISLPERTDKQDTFAMQAAFSEISYILADGVHGDKVPAKA
LPHTMSQKANVIGCWRAHLNVYQKIVHERVSTALVFEDDADWDVALKHQLVQFARGSRFL
ADTVEGDLAHSPYGDDWDMLWIGHCGTWVLPDKNRRFFVIPSDPTVLPPQLREDNVAKPD
MSRWRTNPDGGEQTRIVFHSEGAVCTSAYAISQKGARKAIYYLSMVPYNAPVDWGLANLC
KNKEHNFKCVSSWPQLVGVSRPTSNTAKWSDIDSPPDSESTAQDGHSYHLMYSARQNLQH
WLNGTRIFESQYPDIAPPMGISDIGKAIGYPEILVG

Enzyme Prediction     

No EC number prediction in PV07_04705-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	76	294	7.6e-28	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.31e-18	78	163	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	9.18e-11	76	293	1	197	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	2.25e-08	75	294	1	185	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUW31129.1|GT25	2.82e-69	64	374	61	372
CAP93867.1|GT25	9.49e-62	69	392	60	380
QMW48687.1|GT25	2.70e-61	69	390	50	366
QRD92316.1|GT25	2.70e-61	69	390	50	366
QMW36631.1|GT25	2.70e-61	69	390	50	366

PDB Hits     

PV07_04705-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6NVG7|GT252_MOUSE	3.06e-09	40	356	301	597	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
sp|Q8IYK4|GT252_HUMAN	5.40e-09	40	357	302	599	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
sp|Q8K297|GT251_MOUSE	1.25e-08	71	333	330	567	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|Q8NBJ5|GT251_HUMAN	1.26e-08	72	280	336	510	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000030

TMHMM  Annotations     

Start	End
7	29