CAZyme Information: PV07_03295-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_03295-t44_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	KN847041.1|CGC26	42373.56	6.6843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847041.1:2876620-2878023(+)

Full Sequence      

MKLFSSAGLFALGASLFASSTTSSALPRQSSSKPWSLKSFNSLITFGDSYTDESRLGWFI
NHNGSAPPAGTLLPETFSAPGGGRTWPRYVVQYTGATVQGKWTPQMTLYDYAVSGAVCSN
NITPRWFPAIDAPFPSVLEYEVPAFVADIPATRVNSTPAVQLFTPKLTAQDAVYALWIGT
NDLGVYAFLTDSQIPGKVLSDYTSCVYNVFDKLYASGARHFVLMNTAPLNLAPLYANDSL
HGVGANQYWANKTANHTEIAYAMQQFTTTVNNVFKYQTPYELLVANRYPGAHFALFDTHA
LITDIYNAPANYLNGTGVVKGGECVWGYENHCTVDQKTCVKRQNGTNPDGYLWFDELHPS
EQTDRIIARNFVQVLNGTSKYATYY

Enzyme Prediction     

No EC number prediction in PV07_03295-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	43	371	4.1e-65	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.89e-45	42	374	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.23e-16	172	373	130	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	3.84e-11	11	368	4	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.19e-06	40	375	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.003	172	371	80	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	2.44e-114	32	385	33	357
CCD46398.1|CE16	1.33e-110	40	385	63	387
ATZ51743.1|CE16	2.16e-110	40	385	78	402
QMW44554.1|CE16	4.63e-108	35	385	26	353
QRD84022.1|CE16	4.63e-108	35	385	26	353

PDB Hits     

PV07_03295-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	1.25e-90	40	385	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999697	CS pos: 28-29. Pr: 0.6680

TMHMM  Annotations     

There is no transmembrane helices in PV07_03295-t44_1-p1.