CAZyme Information: PV07_03106-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_03106-t44_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		65069.85	7.3780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847041.1:2297165-2299036(+)

Full Sequence      

MAAHRETFDFIVVGAGNSGAVIASKIAHSNAAPNVLLIEAGGDAQRPELYLPSQRYTSVH
HYPDIRFDYQTTPQKHLDGRILTYYRGRGLGGSSLANYLGYIRGAASDYNTWASMVGDDA
YKWDNVLERYKEIENLSFEDDNDENQWVKLVEGAHSTKGPLGLQLFPRKQWPRGNDILMQ
AAQDFGWPINPDQNSGHPIGLAAVTTTSYEGSRTTSATAYLSNLPPNLHIWTNTIAHRII
LEDNPAEDVLRAAGVVLADGREVRAKAETILSLGSIDTPKILLLSGIGPKDELQELGIPC
RVNLPRVGKDMLDHVFLPLRWGCSSALSDKMAYASNKPALLAARKEWLRSRTGSEAFREL
ANLVGFLKLDKKLYSQEELSKLPREVQQRINQPDAPQFEVFLAGDVPRVLERQNGEDAIG
MCVMLMNPQSRGSVILSSNDPHAVPVIDGNFLAHPYDRATLVDGTRELLRFVNSAHLSKY
IGGRYHAPKTDSKEDVLAFIRKELGSVLHPVATVKMGRADDPTACVDTNMCVRGVKNLRV
VDLSVCPVLTNNHTQSTAYLVGQIGWKKVAEKYGLRDGRRDTLGRERL

Enzyme Prediction     

No EC number prediction in PV07_03106-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	565	1.5e-144	0.9841549295774648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.18e-87	6	551	4	513	choline dehydrogenase; Validated
225186	BetA	1.72e-84	1	562	1	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.21e-34	428	562	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.83e-29	78	314	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.05e-20	6	574	54	582	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS48722.1|AA3_2	6.12e-125	6	576	3	566
QSS73506.1|AA3_2	8.64e-125	6	576	3	566
QDS74375.1|AA3_2	6.11e-120	5	575	8	568
ATZ54666.1|AA3_2	7.97e-117	5	588	6	590
QDS72994.1|AA3_2	2.58e-115	8	575	3	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.26e-63	8	565	2	557	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.21e-63	8	565	3	558	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	6.53e-62	8	573	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3T37_A	9.76e-43	4	550	14	501	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4HA6_A	1.15e-40	9	550	3	485	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|V5NC32|PDH1_AGAXA	3.25e-62	8	573	41	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L243|PDH2_LEUMG	4.52e-62	8	573	41	599	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|V5NDL4|PDH1_AGACM	7.91e-62	8	573	37	594	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.23e-61	8	573	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L245|PDH1_LEUMG	3.36e-61	8	573	41	601	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PV07_03106-t44_1-p1.