CAZyme Information: PV07_02848-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_02848-t44_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	KN847041.1|CGC11	58260.06	5.6110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847041.1:1497156-1498793(+)

Full Sequence      

MAAAEGTFDYIIVGGGIAGCTLASLLSKSKSTPSVLLIEAGADVSAHPLTQAPLACFGAH
GSDIDWNYKTVPQPHLNDRSLYEAGGKALGGGSATNYATWTRGSKVDYDRWGKLVGDARW
SYDGLLPYFERTEKDHISVVTVSKSSPNRKYPLRDEVLKAWLDLGLDKIENANSGNPLGV
GELIENWKDGKRQLTSSAFDLRDTKVMTETAAQRVLLEERQGMLTATGVQLHDGRHFLAS
KEVILSAGAFRTPQLLMLSGIGSAAELKKVTIPPQLDLPGVGQNFHDHLLVGFAFRLKDP
SLGLAMGGAAGPWGDPVYQFGLPGDWIVTENVPRPILEEAVKKDTAGDPSRGEDEYAVSL
LDPRSAHLESIIIYAPGGQPITNLHVPFDGTHMGAVLGAMSPTSRGWISISSASALDPPV
IDPNYNATNVDRTIMRYGIRRLLKAVSSMSDMIESETPPPPLEALTSESSDAAIDARVRS
EARTFFHAAGTASMGSVVDTELRVKGVSGLRVVDASVIPLPICGHLQVATYAIAAQAADL
ITQEK

Enzyme Prediction     

No EC number prediction in PV07_02848-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	543	1.3e-138	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.14e-95	4	526	2	516	choline dehydrogenase; Validated
225186	BetA	2.02e-83	1	528	1	520	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	4.66e-37	77	289	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	5.16e-34	402	527	1	133	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.51e-32	7	517	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ94523.1|AA3_2	4.46e-185	9	541	10	551
UKZ69664.1|AA3_2	2.06e-183	7	541	8	551
BCS24407.1|AA3_2	1.84e-175	9	542	5	560
EAA58856.1|AA3_2	1.18e-174	8	541	6	553
BCS16263.1|AA3_2	2.04e-172	7	541	4	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	4.77e-58	8	545	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	1.74e-57	8	545	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3Q9T_A	3.02e-57	8	544	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.18e-57	8	544	7	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.18e-57	8	544	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.07e-119	7	541	4	518	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	7.19e-65	7	545	6	537	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.14e-60	5	541	33	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.87e-58	8	544	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q12062|AFLK_ASPPU	1.89e-58	7	538	74	636	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000118

TMHMM  Annotations     

There is no transmembrane helices in PV07_02848-t44_1-p1.