CAZyme Information: PV07_02593-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_02593-t44_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882	KN847041.1|CGC25	94362.58	4.3149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847041.1:665426-668074(-)

Full Sequence      

MLFPFLLLLFTWLARAAPRPVPIEPRQAASSYWLSQIQRQGTVAYGSNPGYKIFRNVKDY
GAVGDGVTDDTAAINNAITDGSRCGQGCDSSTTVPAIVYFPPGTYAVSSPVIQLYYTQFI
GDALTIPTILALPSFQGLAVFDTDPYIPGGNGAQWYTNQNNFYRQIRNFVVDISQMPEDQ
GAGIHWQVAQATSLQNIVFNMRPKSPTNKQQGIFMDNGSGGFMSDLVFNGGNYGAFLGNQ
QFTTRNMTFNGCNTAIFMNWNWLWTLKSVAINQCDVGIDMSNLNNGVNQSVGSVILLDSV
MTGTPIGIKTSYNMTSQPTTGGTLALQNVDFTGVQTAIVGADGTTPILAGGMVVGSWGQG
DTYTPAAGANAGSQKAKREPQGGPLSMQPPSISYYSTTTTTLTVSAIPPPSGILVTTTTV
YVTASPTSTGSASVTLTVSPVPSFNGSASSTVSTNNTVSQPSAETPGVCSPTPVSLQSAR
VQQPLTAPTMAASLMNGNKVFERSKPQYQNVPVSSFVSVKSAGAKGDGVTDDTAAIQNIL
NNATPDQVVYFDHGAYVITDTVMVPSNIRITGEIWPLIMAQGTAFSDINNPKPVFQVGAS
GDVGSVEISDLVFETLGPAPGAIIMQWNVAEASQGSCGMWDVHFRIGGTAGTQLQQDTCQ
ANVTGSFEFKPQCAGSFLLMHITQEASAYLENCWFWVADHELDITTHNQTNIYNGRGLLV
ESQGPVWLYGTSSEHSQLYNYQFSNARDIFMGAIQTETPYMQATPNALQGGFPPTSAFSD
PTFADCTTDSCKKSWGLRIVDSSDIHMYGAGLYSFFDNYLQTCLDTESCQENMVDIQCSS
NISLYGLTTKASVNMVNVDGTPEAIGQDHENLFGQTLLLFET

Enzyme Prediction     

EC	3.2.1.58:16	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	423	880	9e-167	0.6121621621621621
GH55	26	378	1.3e-135	0.4648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.92e-94	54	279	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	6.13e-11	516	634	1	128	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	1.36e-05	56	106	84	125	Polygalacturonase [Carbohydrate transport and metabolism].
314993	End_N_terminal	0.004	524	549	1	26	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAF32160.1|GH55	0.0	7	881	15	945
QGA15049.1|GH55	0.0	6	881	617	1514
BCS05967.1|GH55	0.0	29	881	45	948
BCR93323.1|GH55	0.0	29	881	37	940
QMW47168.1|GH55	0.0	27	881	44	948

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	7.61e-300	28	882	2	755	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.99e-209	32	877	26	752	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	1.78e-07	517	596	75	159	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	0.0	14	880	25	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	9.58e-178	23	877	35	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	3.63e-42	489	861	359	738	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999675	CS pos: 16-17. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in PV07_02593-t44_1-p1.