CAZyme Information: PV07_02584-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_02584-t44_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	KN847041.1|CGC8	66523.90	5.2393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847041.1:613250-615224(-)

Full Sequence      

MESEHPPASGVFCSLDAFLADTFDYVVVGGGTAGAVVAARLSEDASVRVGVVEAGQNRLG
DPLVETPGTLAFLLRNPDYAWDFTTVPQKANNNKAHHVTRGKVLGGSSAINFMAYCYPSA
RDFDELKKLGISGWSWDEMAPYFHRVEHYDPPTTPEPDFYPIDAATHGQEGPIHTSSAST
RNAAEDALLEALKETSGLPLVKEPYSGDHLGWYGSLSTIDRSVNRGTRSYAATGYIAPIL
DRPNLKILTEATATKVILDDSRTARGVVFAHGGRDRDQLHTVRAKAEVVLSAGSIQTPQL
LELSGIGDPSVLHAAGIRALVENPHVGANAQEQIMTNVSYELADGETSLDSIYLDPAFLP
AQQALYAESREGILANAPGLNGFTSYASLVSASTLERTVSTLTSTSTTAAAAAAGAPPPL
DAQQASILASRLASPCASAIQYVVIPAYCDTRNTHADMSKFMPGPPPASNPCVSLQAVLM
YPASRGSVHVACADPFAEPRIDYGLLAHPADVDVLAAGLAFVDRVFRSPHIRPRVKRRVY
PAEAVDVQDPATARDTVSEAVTLINHPLGTCALGKVVDERLRVVGVRGLRVVDASVLPME
VSANTMATVYAIGEKGAAMVKEDRGSE

Enzyme Prediction     

No EC number prediction in PV07_02584-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	623	2.9e-172	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.07e-91	16	625	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.52e-86	22	621	5	532	choline dehydrogenase; Validated
274888	Rv0697	1.30e-43	24	620	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.39e-30	92	331	15	214	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.69e-20	482	615	1	142	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47931.1|AA3_2	5.85e-182	18	626	9	620
ALI92648.1|AA3_2	9.78e-178	18	625	9	613
AMU19396.1|AA3_2	9.78e-178	18	625	9	613
UBX54549.1|AA3_2	6.10e-176	18	623	9	610
UPX44764.1|AA3_2	2.87e-174	18	625	9	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.89e-65	23	624	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.00e-64	23	624	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	2.68e-57	22	626	5	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	4.71e-57	23	620	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
2JBV_A	1.61e-56	23	627	14	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.68e-178	12	623	3	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.74e-178	18	625	9	613	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.74e-178	18	625	9	613	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.39e-81	17	623	34	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.00e-71	22	620	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999733	0.000310

TMHMM  Annotations     

There is no transmembrane helices in PV07_02584-t44_1-p1.