CAZyme Information: PV07_02108-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_02108-t44_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	KN847040.1|CGC18	46203.85	8.1943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847040.1:7211091-7212678(+)

Full Sequence      

MHRNAFRIPASTSCQETKLEASNVISNNAQPRKTTQPTVPRLLSARRESKNNEISDKKGV
NHHLGRQAIHPEAMPFKDALAHFKSQIKDLQQEGQKIFSGGQQQRQHQDPQQYPGAQQHQ
PPPIPQSTRPNQQQFHPPGGQPGFPPQQPAIYWQARFDPAVPVSAEWEHKLGNNNGWGNN
EIEHYTAEGGNSFYTPNNLLVLRATSSPNNPDPTKKYTSARLVSRQRLSRPQGSLVATLT
LPCAGGIWPAFWLLPFEPFAWPTDGEVDIAETWNGDGVNHSCLHWGFYTPQDTMKHRVVA
TPVQGMAGGRPVRFEFAWMQDTSAGPGQGQGRLLWWIDGQAVMKAPIPQGTRPMADFVVL
LNIAMGGNVCAGQIPREGSYDMAVHEMKMIEEPEAGGWARFERDWAWVREGNTI

Enzyme Prediction     

No EC number prediction in PV07_02108-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	153	372	2.3e-34	0.9130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	2.95e-24	181	368	29	212	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	1.03e-13	153	368	6	233	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185683	Glyco_hydrolase_16	7.04e-11	191	384	31	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185690	GH16_fungal_Lam16A_glucanase	1.34e-09	193	284	44	130	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
225182	BglS	8.45e-06	191	369	79	241	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49380.1|GH16	4.50e-112	147	413	44	306
CEI66150.1|GH16	5.52e-112	139	413	42	312
QGI63694.1|GH16	2.66e-111	139	413	43	307
CCT67677.1|GH16	2.66e-111	139	413	43	307
QGI94576.1|GH16	2.66e-111	139	413	43	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JH5_A	5.47e-23	151	368	6	208	Structure of Marine bacterial laminarinase [Aquimarina]
6JHJ_A	3.69e-22	151	368	6	208	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
4CRQ_A	5.21e-21	151	368	5	207	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2HYK_A	2.33e-20	151	368	9	219	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ATG_A	1.21e-18	151	367	5	214	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45798|GUB_RHOMR	1.60e-16	151	367	42	257	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
sp|P23903|E13B_NIACI	5.65e-16	146	375	415	662	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|Q27082|CFGA_TACTR	1.31e-13	151	368	27	229	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|C1IE32|E13B_CRYAT	1.15e-12	153	407	24	269	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PV07_02108-t44_1-p1.