CAZyme Information: PV07_01616-t44_1-p1

Basic Information

• Species: Cladophialophora immunda
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora immunda
• CAZyme ID: PV07_01616-t44_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		46401.74	4.0066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmundaCBS83496	12879	N/A	49	12830

• Gene Location: location=KN847040.1:5535160-5536641(-)

Full Sequence      

MAGRVLHSLVFVAAALAPAISAQTTCGGGVLCPSDTPCCSQYGQCGVGAYCLGGCDPVNS
FSLDSCVPAPVCQSQTYDFNNLNRVMANTKYLGDATQADWVSSGSPLEYNNSVLLTMAEG
TVGTLLASTRSVWYGKVSARFATSAGAGVVTAFILLGNSKDEIDFEFVGTQLTSAQTNFY
SQGVPVYTNGGNTTGLEDVHANFHDYEIDWQPDSITWSIDGNAVRTLNREDTWNETANRY
YYPQTPCQVQLSLWPGGLPSNGEGTIEWAGGLVQWDSPYMTNGYYYAQFDSVSVQCYDPP
SGANVQGSKSYIFTDPAMTNNTVEVTNDNTVLKSFLGTGTNMSAGSNTASSSGSSKTSEP
ATVPGLSGVGTGTNGGRGDNTTDNSGSGSSGDSGSGSNSASATGAASTGFVQGDGGDSSN
GAGQIGGKSETVLKGSLFAVVVAVVGLCMV

Enzyme Prediction     

No EC number prediction in PV07_01616-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	108	273	7.7e-73	0.9482758620689655

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	2.06e-87	89	298	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.44e-49	110	270	10	168	Glycosyl hydrolases family 16.
225182	BglS	3.43e-22	123	278	106	260	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	3.87e-22	134	293	68	209	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
211314	ChtBD1_GH16	5.30e-20	24	70	1	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW99574.1|CBM18|GH16_19	6.05e-152	13	370	8	377
QGA20403.1|CBM18|GH16_19	2.24e-148	10	447	7	422
QKX53550.1|CBM18|GH16_19	1.23e-145	11	349	8	349
SMQ45067.1|CBM18|GH16_19	2.48e-141	20	370	18	369
SMR41421.1|CBM18|GH16_19	2.48e-141	20	370	18	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	7.00e-33	83	315	14	234	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1GBG_A	1.57e-15	128	270	66	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3D6E_A	3.07e-15	128	270	53	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
3O5S_A	5.98e-15	128	270	90	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1CPN_A	8.83e-15	128	270	8	136	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	8.91e-132	9	368	10	373	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|P32623|CRH2_YEAST	6.06e-102	20	350	21	355	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q5AJC0|UTR2_CANAL	7.34e-98	19	310	22	316	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	1.04e-60	32	306	37	363	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q75A41|CRR1_ASHGO	1.29e-56	32	298	37	363	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999765	CS pos: 22-23. Pr: 0.9608

TMHMM  Annotations     

There is no transmembrane helices in PV07_01616-t44_1-p1.